F333871

General Info

Members Datasets Scaffolds Average Seq Length
221 164 442 163

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_4161_c1|nmdc:mga06r32_4161_c1_10641_11225
Length 194
Sequence MVAKGLRTRAPEPGSCAGKLTDNRRRQRPEVTPLSDDQIRRQLLRHCLATLAYRGGKAIRDTPPGFAKFRAAPGSRSTGEILAHVGDLFDWAAALVEGRHFWEDSAARSWPAECERFFAALARFDAALAGKEVLDATAERLFQGPIADAFTHIGQIAMLRRLAGAPVRGENYFKAEIVAGRVGPDQAPPVKEFG

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
61 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
112 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
113 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
114 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 21.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_4161_c1 3300050510 Bacteria 12959
2 Ga0065704_10477829 3300005289 Bacteria 684
3 Ga0070690_100083799 3300005330 Bacteria 2089
4 Ga0070670_100055801 3300005331 Bacteria 3390
5 Ga0070670_100133480 3300005331 Bacteria 2145
6 Ga0070677_10005891 3300005333 Bacteria 4060
7 Ga0070666_10464670 3300005335 Bacteria 915
8 Ga0070661_100054889 3300005344 Unclassified 2918
9 Ga0070692_10400950 3300005345 Bacteria 866
10 Ga0070668_100331587 3300005347 Unclassified 1283
11 Ga0070669_100016706 3300005353 Bacteria 5238
12 Ga0070675_100007525 3300005354 Bacteria 8417
13 Ga0070675_100021020 3300005354 Bacteria 5211
14 Ga0070674_100013857 3300005356 Bacteria 4996
15 Ga0070673_100071501 3300005364 Bacteria 2788
16 Ga0070673_100146586 3300005364 Bacteria 1996
17 Ga0070659_100183412 3300005366 Unclassified 1718
18 Ga0070667_100077899 3300005367 Bacteria 2831
19 Ga0070709_10006550 3300005434 Bacteria 6352
20 Ga0070709_10314379 3300005434 Bacteria 1148
21 Ga0070711_100128831 3300005439 Bacteria 1882
22 Ga0070711_100652725 3300005439 Bacteria 882
23 Ga0070708_101233912 3300005445 Unclassified 699
24 Ga0070663_100016259 3300005455 Bacteria 4826
25 Ga0070663_100292088 3300005455 Unclassified 1302
26 Ga0070678_100005165 3300005456 Bacteria 7502
27 Ga0070662_100283388 3300005457 Bacteria 1342
28 Ga0068867_100016938 3300005459 Bacteria 5178
29 Ga0068867_100027503 3300005459 Bacteria 4087
30 Ga0070706_100322454 3300005467 Unclassified 1441
31 Ga0070707_100115587 3300005468 Bacteria 2604
32 Ga0070672_100002741 3300005543 Bacteria 11281
33 Ga0070672_100033267 3300005543 Unclassified 3902
34 Ga0070672_100045031 3300005543 Bacteria 3410
35 Ga0070696_100150230 3300005546 Bacteria 1709
36 Ga0070665_100007858 3300005548 Bacteria 10818
37 Ga0070665_101337616 3300005548 Unclassified 726
38 Ga0068855_100173756 3300005563 Bacteria 2439
39 Ga0070664_100054680 3300005564 Unclassified 3388
40 Ga0068857_100010996 3300005577 Bacteria 7879
41 Ga0068854_100058083 3300005578 Unclassified 2791
42 Ga0068856_100003774 3300005614 Bacteria 15180
43 Ga0068859_100003430 3300005617 Bacteria 16121
44 Ga0068859_100046698 3300005617 Bacteria 4349
45 Ga0068859_100323148 3300005617 Unclassified 1637
46 Ga0068864_100008102 3300005618 Bacteria 8663
47 Ga0068851_10229051 3300005834 Bacteria 1047
48 Ga0068870_10004884 3300005840 Bacteria 5800
49 Ga0068870_10167751 3300005840 Bacteria 1307
50 Ga0068863_100065667 3300005841 Bacteria 3433
51 Ga0068863_100425434 3300005841 Bacteria 1301
52 Ga0068858_100270814 3300005842 Bacteria 1616
53 Ga0068860_100001265 3300005843 Bacteria 27607
54 Ga0068860_100072877 3300005843 Bacteria 3264
55 Ga0081539_10002562 3300005985 Bacteria 25196
56 Ga0075428_100050426 3300006844 Bacteria 4565
57 Ga0075428_100220108 3300006844 Bacteria 2050
58 Ga0075428_100224714 3300006844 Bacteria 2027
59 Ga0075428_100537061 3300006844 Bacteria 1250
60 Ga0075428_100553417 3300006844 Bacteria 1230
61 Ga0075428_100958833 3300006844 Unclassified 906
62 Ga0075431_100000666 3300006847 Bacteria 29299
63 Ga0075431_100489597 3300006847 Bacteria 1222
64 Ga0075431_100777179 3300006847 Unclassified 932
65 Ga0075431_101089149 3300006847 Unclassified 764
66 Ga0075433_10145986 3300006852 Bacteria 2103
67 Ga0075433_10237379 3300006852 Unclassified 1619
68 Ga0075429_101417406 3300006880 Bacteria 605
69 Ga0068865_100088726 3300006881 Bacteria 2238
70 Ga0068865_100162428 3300006881 Unclassified 1705
71 Ga0075436_100077817 3300006914 Bacteria 2297
72 Ga0097620_100003430 3300006931 Bacteria 16121
73 Ga0097620_100046699 3300006931 Bacteria 4349
74 Ga0097620_100323140 3300006931 Unclassified 1637
75 Ga0111539_10084705 3300009094 Bacteria 3726
76 Ga0111539_11603079 3300009094 Unclassified 755
77 Ga0114129_10001733 3300009147 Bacteria 29708
78 Ga0114129_10747891 3300009147 Unclassified 1252
79 Ga0114129_10851359 3300009147 Unclassified 1159
80 Ga0105243_10756897 3300009148 Bacteria 953
81 Ga0105238_10000025 3300009551 Bacteria 196198
82 Ga0105249_10665832 3300009553 Unclassified 1099
83 Ga0157373_10249124 3300013100 Bacteria 1256
84 Ga0163162_10134953 3300013306 Bacteria 2578
85 Ga0157375_10002444 3300013308 Bacteria 16069
86 Ga0157375_10021199 3300013308 Bacteria 5953
87 Ga0163163_10320134 3300014325 Bacteria 1605
88 Ga0157380_10016764 3300014326 Bacteria 5410
89 Ga0157380_11405525 3300014326 Bacteria 748
90 Ga0157377_10075893 3300014745 Bacteria 1953
91 Ga0163161_11218240 3300017792 Bacteria 651
92 Ga0224569_101719 3300022732 Bacteria 1818
93 Ga0224571_100876 3300022734 Unclassified 1795
94 Ga0207697_10009088 3300025315 Bacteria 4306
95 Ga0207682_10001139 3300025893 Bacteria 12314
96 Ga0207699_10008584 3300025906 Bacteria 5049
97 Ga0207699_10214856 3300025906 Bacteria 1310
98 Ga0207699_10326762 3300025906 Bacteria 1077
99 Ga0207645_10001979 3300025907 Bacteria 16458
100 Ga0207643_10002572 3300025908 Bacteria 9825
101 Ga0207695_10040539 3300025913 Bacteria 4990
102 Ga0207663_10229639 3300025916 Bacteria 1355
103 Ga0207657_10534326 3300025919 Bacteria 917
104 Ga0207649_10116470 3300025920 Bacteria 1794
105 Ga0207681_10139891 3300025923 Unclassified 1801
106 Ga0207681_10915888 3300025923 Bacteria 734
107 Ga0207650_10033181 3300025925 Unclassified 3737
108 Ga0207650_10065445 3300025925 Bacteria 2724
109 Ga0207650_10119643 3300025925 Bacteria 2048
110 Ga0207659_10007601 3300025926 Bacteria 6679
111 Ga0207659_10014984 3300025926 Bacteria 5013
112 Ga0207700_10707958 3300025928 Bacteria 899
113 Ga0207644_10241184 3300025931 Bacteria 1439
114 Ga0207706_10047423 3300025933 Bacteria 3801
115 Ga0207709_10104336 3300025935 Bacteria 1881
116 Ga0207669_10158797 3300025937 Bacteria 1594
117 Ga0207704_10044485 3300025938 Bacteria 2631
118 Ga0207665_10041084 3300025939 Bacteria 3087
119 Ga0207691_10002400 3300025940 Bacteria 18334
120 Ga0207691_10007472 3300025940 Bacteria 10521
121 Ga0207691_10012039 3300025940 Bacteria 8297
122 Ga0207711_10000328 3300025941 Bacteria 50666
123 Ga0207689_10100013 3300025942 Bacteria 2383
124 Ga0207661_10327430 3300025944 Bacteria 1378
125 Ga0207679_10139470 3300025945 Unclassified 1958
126 Ga0207667_10176377 3300025949 Bacteria 2195
127 Ga0207667_11063270 3300025949 Bacteria 794
128 Ga0207651_10033714 3300025960 Bacteria 3306
129 Ga0207668_10054177 3300025972 Bacteria 2783
130 Ga0207658_10015257 3300025986 Bacteria 5271
131 Ga0207703_10355110 3300026035 Bacteria 1350
132 Ga0207678_10067926 3300026067 Bacteria 3059
133 Ga0207708_10040986 3300026075 Bacteria 3531
134 Ga0207648_10044908 3300026089 Bacteria 3876
135 Ga0207648_10052131 3300026089 Unclassified 3577
136 Ga0207676_10042457 3300026095 Bacteria 3498
137 Ga0207674_10066004 3300026116 Bacteria 3646
138 Ga0207675_100062996 3300026118 Bacteria 3465
139 Ga0207675_100589987 3300026118 Unclassified 1113
140 Ga0207683_10195885 3300026121 Bacteria 1836
141 Ga0207698_10271918 3300026142 Unclassified 1562
142 Ga0209968_1015325 3300027526 Unclassified 1212
143 Ga0209999_1038004 3300027543 Bacteria 900
144 Ga0209983_1006362 3300027665 Bacteria 2426
145 Ga0209974_10004199 3300027876 Bacteria 5148
146 Ga0268266_10075435 3300028379 Bacteria 2929
147 Ga0268265_10662613 3300028380 Bacteria 1004
148 Ga0268264_10017668 3300028381 Bacteria 5840
149 Ga0268264_10422596 3300028381 Bacteria 1286
150 Ga0265770_1003553 3300030878 Bacteria 2119
151 Ga0265760_10087383 3300031090 Unclassified 972
152 Ga0265330_10111088 3300031235 Unclassified 1171
153 Ga0265328_10016855 3300031239 Bacteria 2837
154 Ga0265342_10188945 3300031712 Bacteria 1125
155 Ga0316578_10018544 3300031728 Bacteria 3817
156 Ga0316577_10004017 3300031733 Bacteria 7533
157 Ga0316585_10111368 3300032137 Unclassified 899
158 Ga0373930_0017682 3300034816 Bacteria 1362
159 Ga0373926_0171138 3300035083 Bacteria 831
160 Ga0373929_0000011 3300035085 Bacteria 190392
161 Ga0373923_0103508 3300035111 Unclassified 1258
162 Ga0373953_0005240 3300035117 Unclassified 4193
163 Ga0373954_0002002 3300035118 Bacteria 8467
164 Ga0373954_0057520 3300035118 Bacteria 1832
165 Ga0373957_0241384 3300035120 Unclassified 759
166 Ga0373955_0379918 3300035172 Bacteria 857
167 Ga0373955_0557064 3300035172 Unclassified 701
168 Ga0373961_0002935 3300035241 Bacteria 4314
169 Ga0373935_0265741 3300035692 Bacteria 1204
170 Ga0373933_0030833 3300035724 Bacteria 3106
171 Ga0373933_0196444 3300035724 Bacteria 1290
172 Ga0373947_0199321 3300035725 Bacteria 1309
173 Ga0373937_0004105 3300036401 Bacteria 12350
174 Ga0373937_0030318 3300036401 Bacteria 4899
175 Ga0373937_0030792 3300036401 Unclassified 4861
176 Ga0316582_0003055 3300036647 Bacteria 8082
177 Ga0316584_0002883 3300036712 Bacteria 11030
178 Ga0373925_0405655 3300037068 Unclassified 1112
179 Ga0466966_0763537 3300044684 Unclassified 583
180 Ga0453684_0157549 3300044712 Unclassified 2690
181 Ga0495651_0244381 3300046462 Unclassified 1229
182 Ga0495580_0186841 3300046472 Bacteria 1430
183 Ga0495582_0244257 3300046473 Bacteria 1029
184 Ga0495582_0317471 3300046473 Bacteria 896
185 Ga0495639_0206855 3300046475 Unclassified 962
186 Ga0495618_0751057 3300046514 Unclassified 571
187 Ga0495620_0174723 3300046515 Bacteria 832
188 Ga0495666_0105818 3300046526 Bacteria 1324
189 Ga0495642_0457947 3300046528 Bacteria 564
190 Ga0495665_0191975 3300046531 Bacteria 1060
191 Ga0495587_0146255 3300046536 Bacteria 1348
192 Ga0495598_0000518 3300046537 Bacteria 7152
193 Ga0495635_0104577 3300046663 Bacteria 1935
194 Ga0495635_0157656 3300046663 Bacteria 1545
195 Ga0495657_0787147 3300046675 Unclassified 544
196 Ga0495658_0037228 3300046683 Bacteria 2688
197 Ga0495674_0504828 3300047319 Bacteria 967
198 Ga0495680_0089038 3300047322 Bacteria 2318
199 Ga0495680_0218370 3300047322 Bacteria 1362
200 Ga0495684_0148148 3300047471 Bacteria 1756
201 Ga0495684_0359973 3300047471 Bacteria 1031
202 Ga0495684_0681238 3300047471 Bacteria 684
203 Ga0496100_0076469 3300048903 Bacteria 2248
204 Ga0496105_0103457 3300048908 Bacteria 2352
205 Ga0496107_0288942 3300048910 Bacteria 1220
206 Ga0501036_0793374 3300049572 Unclassified 780
207 Ga0501040_0128188 3300049576 Bacteria 1783
208 Ga0501042_0529914 3300049578 Bacteria 856
209 Ga0501075_0192913 3300049591 Bacteria 1554
210 Ga0501079_0092956 3300049741 Bacteria 2337
211 Ga0501079_0579288 3300049741 Bacteria 883
212 Ga0501080_0651983 3300049742 Bacteria 931
213 Ga0501080_0817711 3300049742 Bacteria 816
214 Ga0501081_0398326 3300049743 Bacteria 1019
215 nmdc:mga09592_25466_c1 3300050508 Bacteria 4896
216 nmdc:mga0n895_158208_c1 3300050512 Unclassified 2297
217 nmdc:mga08x19_84590_c1 3300050514 Bacteria 2087
218 Ga0495619_0219186 3300053085 Unclassified 1318
219 Ga0500566_0291727 3300053094 Unclassified 772
220 Ga0501082_0166457 3300060353 Bacteria 1916
221 Ga0501082_1350007 3300060353 Bacteria 623
222 nmdc:mga06r32_4161_c1
223 Ga0065704_10477829
224 Ga0070690_100083799
225 Ga0070670_100055801
226 Ga0070670_100133480
227 Ga0070677_10005891
228 Ga0070666_10464670
229 Ga0070661_100054889
230 Ga0070692_10400950
231 Ga0070668_100331587
232 Ga0070669_100016706
233 Ga0070675_100007525
234 Ga0070675_100021020
235 Ga0070674_100013857
236 Ga0070673_100071501
237 Ga0070673_100146586
238 Ga0070659_100183412
239 Ga0070667_100077899
240 Ga0070709_10006550
241 Ga0070709_10314379
242 Ga0070711_100128831
243 Ga0070711_100652725
244 Ga0070708_101233912
245 Ga0070663_100016259
246 Ga0070663_100292088
247 Ga0070678_100005165
248 Ga0070662_100283388
249 Ga0068867_100016938
250 Ga0068867_100027503
251 Ga0070706_100322454
252 Ga0070707_100115587
253 Ga0070672_100002741
254 Ga0070672_100033267
255 Ga0070672_100045031
256 Ga0070696_100150230
257 Ga0070665_100007858
258 Ga0070665_101337616
259 Ga0068855_100173756
260 Ga0070664_100054680
261 Ga0068857_100010996
262 Ga0068854_100058083
263 Ga0068856_100003774
264 Ga0068859_100003430
265 Ga0068859_100046698
266 Ga0068859_100323148
267 Ga0068864_100008102
268 Ga0068851_10229051
269 Ga0068870_10004884
270 Ga0068870_10167751
271 Ga0068863_100065667
272 Ga0068863_100425434
273 Ga0068858_100270814
274 Ga0068860_100001265
275 Ga0068860_100072877
276 Ga0081539_10002562
277 Ga0075428_100050426
278 Ga0075428_100220108
279 Ga0075428_100224714
280 Ga0075428_100537061
281 Ga0075428_100553417
282 Ga0075428_100958833
283 Ga0075431_100000666
284 Ga0075431_100489597
285 Ga0075431_100777179
286 Ga0075431_101089149
287 Ga0075433_10145986
288 Ga0075433_10237379
289 Ga0075429_101417406
290 Ga0068865_100088726
291 Ga0068865_100162428
292 Ga0075436_100077817
293 Ga0097620_100003430
294 Ga0097620_100046699
295 Ga0097620_100323140
296 Ga0111539_10084705
297 Ga0111539_11603079
298 Ga0114129_10001733
299 Ga0114129_10747891
300 Ga0114129_10851359
301 Ga0105243_10756897
302 Ga0105238_10000025
303 Ga0105249_10665832
304 Ga0157373_10249124
305 Ga0163162_10134953
306 Ga0157375_10002444
307 Ga0157375_10021199
308 Ga0163163_10320134
309 Ga0157380_10016764
310 Ga0157380_11405525
311 Ga0157377_10075893
312 Ga0163161_11218240
313 Ga0224569_101719
314 Ga0224571_100876
315 Ga0207697_10009088
316 Ga0207682_10001139
317 Ga0207699_10008584
318 Ga0207699_10214856
319 Ga0207699_10326762
320 Ga0207645_10001979
321 Ga0207643_10002572
322 Ga0207695_10040539
323 Ga0207663_10229639
324 Ga0207657_10534326
325 Ga0207649_10116470
326 Ga0207681_10139891
327 Ga0207681_10915888
328 Ga0207650_10033181
329 Ga0207650_10065445
330 Ga0207650_10119643
331 Ga0207659_10007601
332 Ga0207659_10014984
333 Ga0207700_10707958
334 Ga0207644_10241184
335 Ga0207706_10047423
336 Ga0207709_10104336
337 Ga0207669_10158797
338 Ga0207704_10044485
339 Ga0207665_10041084
340 Ga0207691_10002400
341 Ga0207691_10007472
342 Ga0207691_10012039
343 Ga0207711_10000328
344 Ga0207689_10100013
345 Ga0207661_10327430
346 Ga0207679_10139470
347 Ga0207667_10176377
348 Ga0207667_11063270
349 Ga0207651_10033714
350 Ga0207668_10054177
351 Ga0207658_10015257
352 Ga0207703_10355110
353 Ga0207678_10067926
354 Ga0207708_10040986
355 Ga0207648_10044908
356 Ga0207648_10052131
357 Ga0207676_10042457
358 Ga0207674_10066004
359 Ga0207675_100062996
360 Ga0207675_100589987
361 Ga0207683_10195885
362 Ga0207698_10271918
363 Ga0209968_1015325
364 Ga0209999_1038004
365 Ga0209983_1006362
366 Ga0209974_10004199
367 Ga0268266_10075435
368 Ga0268265_10662613
369 Ga0268264_10017668
370 Ga0268264_10422596
371 Ga0265770_1003553
372 Ga0265760_10087383
373 Ga0265330_10111088
374 Ga0265328_10016855
375 Ga0265342_10188945
376 Ga0316578_10018544
377 Ga0316577_10004017
378 Ga0316585_10111368
379 Ga0373930_0017682
380 Ga0373926_0171138
381 Ga0373929_0000011
382 Ga0373923_0103508
383 Ga0373953_0005240
384 Ga0373954_0002002
385 Ga0373954_0057520
386 Ga0373957_0241384
387 Ga0373955_0379918
388 Ga0373955_0557064
389 Ga0373961_0002935
390 Ga0373935_0265741
391 Ga0373933_0030833
392 Ga0373933_0196444
393 Ga0373947_0199321
394 Ga0373937_0004105
395 Ga0373937_0030318
396 Ga0373937_0030792
397 Ga0316582_0003055
398 Ga0316584_0002883
399 Ga0373925_0405655
400 Ga0466966_0763537
401 Ga0453684_0157549
402 Ga0495651_0244381
403 Ga0495580_0186841
404 Ga0495582_0244257
405 Ga0495582_0317471
406 Ga0495639_0206855
407 Ga0495618_0751057
408 Ga0495620_0174723
409 Ga0495666_0105818
410 Ga0495642_0457947
411 Ga0495665_0191975
412 Ga0495587_0146255
413 Ga0495598_0000518
414 Ga0495635_0104577
415 Ga0495635_0157656
416 Ga0495657_0787147
417 Ga0495658_0037228
418 Ga0495674_0504828
419 Ga0495680_0089038
420 Ga0495680_0218370
421 Ga0495684_0148148
422 Ga0495684_0359973
423 Ga0495684_0681238
424 Ga0496100_0076469
425 Ga0496105_0103457
426 Ga0496107_0288942
427 Ga0501036_0793374
428 Ga0501040_0128188
429 Ga0501042_0529914
430 Ga0501075_0192913
431 Ga0501079_0092956
432 Ga0501079_0579288
433 Ga0501080_0651983
434 Ga0501080_0817711
435 Ga0501081_0398326
436 nmdc:mga09592_25466_c1
437 nmdc:mga0n895_158208_c1
438 nmdc:mga08x19_84590_c1
439 Ga0495619_0219186
440 Ga0500566_0291727
441 Ga0501082_0166457
442 Ga0501082_1350007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.8128 5 126
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.8061 5 126
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.8047 1 132
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8008 15 128
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7745 1 128
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.822 5 127 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7827 11 123 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7744 1 129 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7531 5 123 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.741 14 127 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A1Q8BNA3-F1-model_v4 DinB-like domain-containing protein 0.9903 4 157
AF-A0A2V9YUY0-F1-model_v4 DinB-like domain-containing protein 0.9898 8 157
AF-A0A2V8SH48-F1-model_v4 DinB-like domain-containing protein 0.989 4 157
AF-A0A317J738-F1-model_v4 DinB-like domain-containing protein 0.9888 9 157
AF-A0A2V7V500-F1-model_v4 DinB-like domain-containing protein 0.9888 2 157

Map