F333614

General Info

Members Datasets Scaffolds Average Seq Length
221 168 442 129

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1203772|Ga0436363_1203772_38_487
Length 149
Sequence LGALYFERLLLRRGETKPMEAMKISSGTAWEPVVGYSRAVRVGSYVHVSGTTATGSDGRIIGSGDAYEQARQTLRNIASALEKAGADLENVVRTRMYVTRIADWEKVGKAHGEFFGKIRPATSLVAVSALVSPDMLVEIEADAFIGSSD

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
128 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
129 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
130 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
131 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
141 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
142 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
143 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 3.17
Rhizosphere 93.67
Stem 0
Stem Tuber 0
Unclassified 30.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_1203772 3300039450 Bacteria 608
2 Ga0068869_101403462 3300005334 Unclassified 618
3 Ga0070666_10103414 3300005335 Bacteria 1965
4 Ga0068868_100257807 3300005338 Unclassified 1470
5 Ga0068868_101598946 3300005338 Unclassified 612
6 Ga0070689_100119176 3300005340 Bacteria 2107
7 Ga0070691_10179029 3300005341 Bacteria 1103
8 Ga0070687_100096204 3300005343 Unclassified 1648
9 Ga0070687_100126968 3300005343 Bacteria 1467
10 Ga0070661_100006491 3300005344 Bacteria 8067
11 Ga0070692_10142959 3300005345 Unclassified 1356
12 Ga0070668_100613048 3300005347 Bacteria 953
13 Ga0070671_100251781 3300005355 Bacteria 1500
14 Ga0070671_101338186 3300005355 Unclassified 632
15 Ga0070673_100109303 3300005364 Bacteria 2291
16 Ga0070673_101021798 3300005364 Unclassified 770
17 Ga0070688_101760294 3300005365 Unclassified 508
18 Ga0070667_100003019 3300005367 Bacteria 14464
19 Ga0070713_101018640 3300005436 Unclassified 799
20 Ga0070713_101368132 3300005436 Bacteria 686
21 Ga0070701_11148312 3300005438 Unclassified 549
22 Ga0070700_100542767 3300005441 Unclassified 902
23 Ga0070708_100015481 3300005445 Bacteria 6302
24 Ga0070708_101480117 3300005445 Bacteria 633
25 Ga0070663_100014708 3300005455 Bacteria 5029
26 Ga0070662_100973131 3300005457 Bacteria 726
27 Ga0070681_10208956 3300005458 Bacteria 1869
28 Ga0070706_100000757 3300005467 Bacteria 36181
29 Ga0070706_100384368 3300005467 Bacteria 1307
30 Ga0070698_100155912 3300005471 Unclassified 2229
31 Ga0070699_100008909 3300005518 Bacteria 8691
32 Ga0070699_101129333 3300005518 Unclassified 719
33 Ga0070684_100336565 3300005535 Unclassified 1387
34 Ga0070697_100024609 3300005536 Bacteria 4795
35 Ga0070697_100158526 3300005536 Bacteria 1911
36 Ga0070697_101038425 3300005536 Bacteria 729
37 Ga0068853_101414938 3300005539 Unclassified 673
38 Ga0070672_100007571 3300005543 Bacteria 7380
39 Ga0070686_100592390 3300005544 Unclassified 872
40 Ga0070665_102035598 3300005548 Bacteria 579
41 Ga0068855_100251151 3300005563 Bacteria 1973
42 Ga0070664_100002667 3300005564 Bacteria 14398
43 Ga0068854_100501776 3300005578 Bacteria 1022
44 Ga0068856_100143867 3300005614 Bacteria 2392
45 Ga0070702_100974785 3300005615 Bacteria 669
46 Ga0068859_100321711 3300005617 Bacteria 1641
47 Ga0068859_100759006 3300005617 Unclassified 1059
48 Ga0068864_100011071 3300005618 Bacteria 7453
49 Ga0068866_10775107 3300005718 Unclassified 664
50 Ga0068863_100001473 3300005841 Bacteria 23304
51 Ga0068863_100041677 3300005841 Bacteria 4366
52 Ga0068863_100380067 3300005841 Unclassified 1379
53 Ga0068863_102525744 3300005841 Unclassified 523
54 Ga0068858_100008483 3300005842 Bacteria 9874
55 Ga0068858_100092385 3300005842 Bacteria 2817
56 Ga0068858_100096749 3300005842 Bacteria 2751
57 Ga0068858_100915392 3300005842 Bacteria 858
58 Ga0068860_100101572 3300005843 Bacteria 2744
59 Ga0068860_102631074 3300005843 Unclassified 522
60 Ga0070717_10017881 3300006028 Bacteria 5528
61 Ga0070712_100053020 3300006175 Unclassified 2831
62 Ga0075369_10012285 3300006186 Bacteria 3382
63 Ga0097621_101316624 3300006237 Unclassified 683
64 Ga0068871_100269872 3300006358 Bacteria 1486
65 Ga0068871_100929750 3300006358 Unclassified 807
66 Ga0075433_10033380 3300006852 Unclassified 4412
67 Ga0097620_100321700 3300006931 Bacteria 1641
68 Ga0097620_100758916 3300006931 Unclassified 1059
69 Ga0105240_10359141 3300009093 Unclassified 1651
70 Ga0105240_11165618 3300009093 Unclassified 817
71 Ga0105245_10143795 3300009098 Bacteria 2249
72 Ga0105243_11254512 3300009148 Unclassified 756
73 Ga0105241_10019759 3300009174 Bacteria 4971
74 Ga0105241_10167142 3300009174 Bacteria 1814
75 Ga0105248_10009988 3300009177 Bacteria 10450
76 Ga0105237_11184910 3300009545 Unclassified 770
77 Ga0105238_10538635 3300009551 Bacteria 1171
78 Ga0105239_10266010 3300010375 Bacteria 1928
79 Ga0105239_11034383 3300010375 Bacteria 945
80 Ga0105246_10301506 3300011119 Bacteria 1294
81 Ga0157373_10004179 3300013100 Bacteria 10890
82 Ga0157370_10571682 3300013104 Bacteria 1036
83 Ga0157369_10054516 3300013105 Unclassified 4317
84 Ga0157374_10016920 3300013296 Bacteria 6418
85 Ga0157374_10178190 3300013296 Unclassified 2075
86 Ga0157374_10223458 3300013296 Bacteria 1848
87 Ga0157378_10919977 3300013297 Unclassified 906
88 Ga0163162_10000943 3300013306 Bacteria 27022
89 Ga0163162_10005391 3300013306 Bacteria 12354
90 Ga0157375_10000556 3300013308 Bacteria 33512
91 Ga0157375_11751442 3300013308 Bacteria 736
92 Ga0163163_10012118 3300014325 Bacteria 7845
93 Ga0163163_10515459 3300014325 Bacteria 1258
94 Ga0157377_10343091 3300014745 Bacteria 999
95 Ga0157379_10033761 3300014968 Bacteria 4564
96 Ga0157379_10197950 3300014968 Bacteria 1816
97 Ga0157379_10264764 3300014968 Bacteria 1563
98 Ga0157376_10036127 3300014969 Unclassified 4000
99 Ga0157376_10615065 3300014969 Bacteria 1083
100 Ga0228598_1007976 3300024227 Bacteria 2146
101 Ga0207680_10008996 3300025903 Bacteria 4930
102 Ga0207685_10219972 3300025905 Bacteria 902
103 Ga0207699_10774531 3300025906 Unclassified 705
104 Ga0207684_10001337 3300025910 Bacteria 27056
105 Ga0207654_10250610 3300025911 Bacteria 1187
106 Ga0207707_10945386 3300025912 Unclassified 710
107 Ga0207695_10905511 3300025913 Unclassified 762
108 Ga0207671_10227664 3300025914 Bacteria 1462
109 Ga0207693_10089580 3300025915 Unclassified 2411
110 Ga0207649_10111306 3300025920 Unclassified 1830
111 Ga0207694_11141290 3300025924 Unclassified 659
112 Ga0207650_10009129 3300025925 Bacteria 6777
113 Ga0207687_10082041 3300025927 Bacteria 2332
114 Ga0207700_10424501 3300025928 Bacteria 1168
115 Ga0207664_11483500 3300025929 Bacteria 600
116 Ga0207644_10210157 3300025931 Bacteria 1538
117 Ga0207644_10883647 3300025931 Bacteria 749
118 Ga0207690_11005904 3300025932 Bacteria 694
119 Ga0207706_10842970 3300025933 Bacteria 777
120 Ga0207670_10329227 3300025936 Unclassified 1204
121 Ga0207691_10025358 3300025940 Bacteria 5568
122 Ga0207689_10408196 3300025942 Bacteria 1133
123 Ga0207679_10007884 3300025945 Bacteria 6766
124 Ga0207667_10917986 3300025949 Unclassified 867
125 Ga0207651_10344283 3300025960 Unclassified 1253
126 Ga0207640_10116955 3300025981 Bacteria 1902
127 Ga0207658_10006773 3300025986 Bacteria 7803
128 Ga0207677_10030253 3300026023 Bacteria 3453
129 Ga0207677_11363325 3300026023 Unclassified 652
130 Ga0207703_10009650 3300026035 Bacteria 7577
131 Ga0207703_10182781 3300026035 Bacteria 1851
132 Ga0207703_10839629 3300026035 Unclassified 878
133 Ga0207703_11636167 3300026035 Unclassified 619
134 Ga0207678_10030324 3300026067 Bacteria 4722
135 Ga0207708_10495443 3300026075 Bacteria 1023
136 Ga0207708_10845808 3300026075 Bacteria 790
137 Ga0207702_10075638 3300026078 Bacteria 2909
138 Ga0207641_10006401 3300026088 Bacteria 9927
139 Ga0207641_10088223 3300026088 Bacteria 2708
140 Ga0207641_12376947 3300026088 Unclassified 529
141 Ga0207648_10123422 3300026089 Unclassified 2277
142 Ga0207676_10004200 3300026095 Bacteria 10181
143 Ga0207676_11185213 3300026095 Unclassified 757
144 Ga0207683_11248111 3300026121 Unclassified 688
145 Ga0209974_10074290 3300027876 Unclassified 1163
146 Ga0268266_10811500 3300028379 Bacteria 904
147 Ga0268265_11193160 3300028380 Unclassified 758
148 Ga0268264_10072975 3300028381 Bacteria 2911
149 Ga0268264_12319060 3300028381 Unclassified 543
150 Ga0265337_1059259 3300028556 Bacteria 1063
151 Ga0265336_10004547 3300028666 Bacteria 5230
152 Ga0265336_10026931 3300028666 Bacteria 1804
153 Ga0265338_10004865 3300028800 Bacteria 17895
154 Ga0265338_10234860 3300028800 Bacteria 1361
155 Ga0265338_10285422 3300028800 Bacteria 1205
156 Ga0265338_10294716 3300028800 Bacteria 1181
157 Ga0265770_1002484 3300030878 Bacteria 2504
158 Ga0265330_10081269 3300031235 Bacteria 1396
159 Ga0265330_10092878 3300031235 Bacteria 1294
160 Ga0265332_10283755 3300031238 Bacteria 684
161 Ga0265328_10006671 3300031239 Bacteria 4861
162 Ga0265320_10130299 3300031240 Bacteria 1143
163 Ga0265329_10072930 3300031242 Bacteria 1086
164 Ga0265340_10090314 3300031247 Bacteria 1433
165 Ga0265331_10014629 3300031250 Bacteria 4169
166 Ga0265316_10339699 3300031344 Bacteria 1088
167 Ga0265342_10432269 3300031712 Bacteria 677
168 Ga0316576_10423172 3300031727 Unclassified 985
169 Ga0307405_10614686 3300031731 Unclassified 889
170 Ga0316577_10122735 3300031733 Unclassified 1460
171 Ga0307416_102106008 3300032002 Unclassified 666
172 Ga0307416_103550149 3300032002 Archaea 522
173 Ga0307414_10367421 3300032004 Unclassified 1240
174 Ga0316583_10002527 3300032133 Bacteria 6368
175 Ga0316212_1015632 3300033547 Unclassified 1072
176 Ga0373930_0021555 3300034816 Bacteria 1267
177 Ga0373948_0023216 3300034817 Bacteria 1202
178 Ga0373938_0088148 3300034957 Bacteria 764
179 Ga0373939_0151324 3300035114 Unclassified 845
180 Ga0373941_0368631 3300035115 Unclassified 588
181 Ga0373942_0004568 3300035207 Bacteria 3209
182 Ga0373931_0007506 3300035691 Bacteria 5134
183 Ga0373931_0009027 3300035691 Bacteria 4754
184 Ga0373933_0598702 3300035724 Bacteria 724
185 Ga0316584_0039973 3300036712 Bacteria 3494
186 Ga0436364_0120252 3300037853 Bacteria 644
187 Ga0436364_0304037 3300037853 Unclassified 1467
188 Ga0436364_0759065 3300037853 Bacteria 1035
189 Ga0436363_0520559 3300039450 Bacteria 889
190 Ga0436362_0924408 3300039453 Bacteria 622
191 Ga0439466_0038667 3300041411 Bacteria 1602
192 Ga0450920_081000 3300042122 Bacteria 665
193 Ga0450923_034177 3300042125 Bacteria 1048
194 Ga0450896_028188 3300042133 Bacteria 842
195 Ga0450908_009063 3300042184 Bacteria 1856
196 Ga0466972_0027213 3300044658 Bacteria 2830
197 Ga0466960_0087983 3300044901 Bacteria 1578
198 Ga0451576_1498467 3300045051 Unclassified 701
199 Ga0495592_0713680 3300046454 Unclassified 602
200 Ga0495638_0073691 3300046460 Bacteria 2083
201 Ga0495580_0704247 3300046472 Bacteria 661
202 Ga0495630_0642908 3300046517 Bacteria 812
203 Ga0495665_0256656 3300046531 Unclassified 899
204 Ga0495635_0378004 3300046663 Bacteria 943
205 Ga0495636_0120596 3300047318 Unclassified 1160
206 Ga0496102_0058737 3300048905 Bacteria 3515
207 Ga0496104_0012026 3300048907 Bacteria 7768
208 Ga0496104_1070512 3300048907 Bacteria 710
209 Ga0496105_0009885 3300048908 Bacteria 7480
210 Ga0496112_0034380 3300048915 Bacteria 4933
211 Ga0496114_0031373 3300048917 Bacteria 4373
212 Ga0496114_0662695 3300048917 Unclassified 917
213 Ga0501048_1054469 3300049582 Bacteria 585
214 Ga0501068_1130418 3300049584 Bacteria 518
215 Ga0501071_1586510 3300049587 Bacteria 505
216 Ga0501076_1250078 3300049592 Bacteria 611
217 Ga0501079_0486581 3300049741 Bacteria 970
218 Ga0501081_0429924 3300049743 Bacteria 980
219 nmdc:mga0a205_36736_c1 3300050515 Unclassified 4708
220 Ga0495601_0948616 3300053077 Bacteria 542
221 Ga0501084_0399754 3300054114 Bacteria 1161
222 Ga0436363_1203772
223 Ga0068869_101403462
224 Ga0070666_10103414
225 Ga0068868_100257807
226 Ga0068868_101598946
227 Ga0070689_100119176
228 Ga0070691_10179029
229 Ga0070687_100096204
230 Ga0070687_100126968
231 Ga0070661_100006491
232 Ga0070692_10142959
233 Ga0070668_100613048
234 Ga0070671_100251781
235 Ga0070671_101338186
236 Ga0070673_100109303
237 Ga0070673_101021798
238 Ga0070688_101760294
239 Ga0070667_100003019
240 Ga0070713_101018640
241 Ga0070713_101368132
242 Ga0070701_11148312
243 Ga0070700_100542767
244 Ga0070708_100015481
245 Ga0070708_101480117
246 Ga0070663_100014708
247 Ga0070662_100973131
248 Ga0070681_10208956
249 Ga0070706_100000757
250 Ga0070706_100384368
251 Ga0070698_100155912
252 Ga0070699_100008909
253 Ga0070699_101129333
254 Ga0070684_100336565
255 Ga0070697_100024609
256 Ga0070697_100158526
257 Ga0070697_101038425
258 Ga0068853_101414938
259 Ga0070672_100007571
260 Ga0070686_100592390
261 Ga0070665_102035598
262 Ga0068855_100251151
263 Ga0070664_100002667
264 Ga0068854_100501776
265 Ga0068856_100143867
266 Ga0070702_100974785
267 Ga0068859_100321711
268 Ga0068859_100759006
269 Ga0068864_100011071
270 Ga0068866_10775107
271 Ga0068863_100001473
272 Ga0068863_100041677
273 Ga0068863_100380067
274 Ga0068863_102525744
275 Ga0068858_100008483
276 Ga0068858_100092385
277 Ga0068858_100096749
278 Ga0068858_100915392
279 Ga0068860_100101572
280 Ga0068860_102631074
281 Ga0070717_10017881
282 Ga0070712_100053020
283 Ga0075369_10012285
284 Ga0097621_101316624
285 Ga0068871_100269872
286 Ga0068871_100929750
287 Ga0075433_10033380
288 Ga0097620_100321700
289 Ga0097620_100758916
290 Ga0105240_10359141
291 Ga0105240_11165618
292 Ga0105245_10143795
293 Ga0105243_11254512
294 Ga0105241_10019759
295 Ga0105241_10167142
296 Ga0105248_10009988
297 Ga0105237_11184910
298 Ga0105238_10538635
299 Ga0105239_10266010
300 Ga0105239_11034383
301 Ga0105246_10301506
302 Ga0157373_10004179
303 Ga0157370_10571682
304 Ga0157369_10054516
305 Ga0157374_10016920
306 Ga0157374_10178190
307 Ga0157374_10223458
308 Ga0157378_10919977
309 Ga0163162_10000943
310 Ga0163162_10005391
311 Ga0157375_10000556
312 Ga0157375_11751442
313 Ga0163163_10012118
314 Ga0163163_10515459
315 Ga0157377_10343091
316 Ga0157379_10033761
317 Ga0157379_10197950
318 Ga0157379_10264764
319 Ga0157376_10036127
320 Ga0157376_10615065
321 Ga0228598_1007976
322 Ga0207680_10008996
323 Ga0207685_10219972
324 Ga0207699_10774531
325 Ga0207684_10001337
326 Ga0207654_10250610
327 Ga0207707_10945386
328 Ga0207695_10905511
329 Ga0207671_10227664
330 Ga0207693_10089580
331 Ga0207649_10111306
332 Ga0207694_11141290
333 Ga0207650_10009129
334 Ga0207687_10082041
335 Ga0207700_10424501
336 Ga0207664_11483500
337 Ga0207644_10210157
338 Ga0207644_10883647
339 Ga0207690_11005904
340 Ga0207706_10842970
341 Ga0207670_10329227
342 Ga0207691_10025358
343 Ga0207689_10408196
344 Ga0207679_10007884
345 Ga0207667_10917986
346 Ga0207651_10344283
347 Ga0207640_10116955
348 Ga0207658_10006773
349 Ga0207677_10030253
350 Ga0207677_11363325
351 Ga0207703_10009650
352 Ga0207703_10182781
353 Ga0207703_10839629
354 Ga0207703_11636167
355 Ga0207678_10030324
356 Ga0207708_10495443
357 Ga0207708_10845808
358 Ga0207702_10075638
359 Ga0207641_10006401
360 Ga0207641_10088223
361 Ga0207641_12376947
362 Ga0207648_10123422
363 Ga0207676_10004200
364 Ga0207676_11185213
365 Ga0207683_11248111
366 Ga0209974_10074290
367 Ga0268266_10811500
368 Ga0268265_11193160
369 Ga0268264_10072975
370 Ga0268264_12319060
371 Ga0265337_1059259
372 Ga0265336_10004547
373 Ga0265336_10026931
374 Ga0265338_10004865
375 Ga0265338_10234860
376 Ga0265338_10285422
377 Ga0265338_10294716
378 Ga0265770_1002484
379 Ga0265330_10081269
380 Ga0265330_10092878
381 Ga0265332_10283755
382 Ga0265328_10006671
383 Ga0265320_10130299
384 Ga0265329_10072930
385 Ga0265340_10090314
386 Ga0265331_10014629
387 Ga0265316_10339699
388 Ga0265342_10432269
389 Ga0316576_10423172
390 Ga0307405_10614686
391 Ga0316577_10122735
392 Ga0307416_102106008
393 Ga0307416_103550149
394 Ga0307414_10367421
395 Ga0316583_10002527
396 Ga0316212_1015632
397 Ga0373930_0021555
398 Ga0373948_0023216
399 Ga0373938_0088148
400 Ga0373939_0151324
401 Ga0373941_0368631
402 Ga0373942_0004568
403 Ga0373931_0007506
404 Ga0373931_0009027
405 Ga0373933_0598702
406 Ga0316584_0039973
407 Ga0436364_0120252
408 Ga0436364_0304037
409 Ga0436364_0759065
410 Ga0436363_0520559
411 Ga0436362_0924408
412 Ga0439466_0038667
413 Ga0450920_081000
414 Ga0450923_034177
415 Ga0450896_028188
416 Ga0450908_009063
417 Ga0466972_0027213
418 Ga0466960_0087983
419 Ga0451576_1498467
420 Ga0495592_0713680
421 Ga0495638_0073691
422 Ga0495580_0704247
423 Ga0495630_0642908
424 Ga0495665_0256656
425 Ga0495635_0378004
426 Ga0495636_0120596
427 Ga0496102_0058737
428 Ga0496104_0012026
429 Ga0496104_1070512
430 Ga0496105_0009885
431 Ga0496112_0034380
432 Ga0496114_0031373
433 Ga0496114_0662695
434 Ga0501048_1054469
435 Ga0501068_1130418
436 Ga0501071_1586510
437 Ga0501076_1250078
438 Ga0501079_0486581
439 Ga0501081_0429924
440 nmdc:mga0a205_36736_c1
441 Ga0495601_0948616
442 Ga0501084_0399754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

26

145

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yu2-assembly1.cif.gz_B structure of ribonuclease yabj 0.9594 21 128
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.9427 21 128
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9419 2 127
6izh-assembly1.cif.gz_F crystal structure of deaminase amne from pseudomonas sp. ap-3 0.9413 21 127
3l7q-assembly2.cif.gz_E crystal structure of aldr from streptococcus mutans 0.9393 21 128
ID Description Score Start End Superfamily
6izhH00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.945 21 127 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9427 21 128 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9419 2 127 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.939 21 128 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.935 21 127 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A7V9JWY7-F1-model_v4 RidA family protein 0.9898 21 127
AF-A0A7Y2D979-F1-model_v4 RidA family protein 0.9893 23 127
AF-T0ZC75-F1-model_v4 Endoribonuclease L-PSP 0.9881 33 129
AF-A0A2R6M1K2-F1-model_v4 RidA family protein 0.984 23 128
AF-A0A2S7K256-F1-model_v4 RidA family protein 0.9809 23 129

Map