F333593

General Info

Members Datasets Scaffolds Average Seq Length
221 163 442 300

Family's Representative Sequence

Representative Sequence 3300037588|Ga0316581_0001675|Ga0316581_0001675_1864_2874
Length 336
Sequence VTGGKNIVTAEQRKVTTRDYRVDHAIDWCPGCGDFGILAALQGALARLGLPPHTVALVGGIGCSGKAQYHVGAYGIHTLHGRLLPYATGIKLANPDLTVVAVGGDGDGMAIGAGHFVNAGRRNVDLTYILFSNEVYGLTKGQAAPTLPLGLQTKSLPEPNMQSRVNSLMLALSAGFTWIGRGYAFAVPQLTKLIGAAIEHPGLSYLEVLQPCPTYNNLHTKDWYGGKDRGGRSRLYAVDKEGYDPLVPVDDSPEAEEIARDRMAGFIEKAHEWGDHIPTGVLLENRNPSTFARRLGVRSATYEEAPPARRPIADGEGRPLADLGPVLAEFDVTAEG

Samples

Sample ID Description Type Environment
1 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
84 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
89 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
90 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
91 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
124 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
146 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
147 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.48
Metatranscriptomes 4.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.9
Rhizosphere 99.1
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316581_0001675 3300037588 Bacteria 5089
2 Ga0058862_10122562 3300004803 Archaea 1523
3 Ga0070690_100118287 3300005330 Bacteria 1776
4 Ga0070687_100059711 3300005343 Bacteria 2009
5 Ga0070675_100000026 3300005354 Bacteria 113553
6 Ga0070673_100294293 3300005364 Bacteria 1427
7 Ga0070673_100343986 3300005364 Bacteria 1322
8 Ga0070659_100214241 3300005366 Bacteria 1588
9 Ga0070667_100176827 3300005367 Bacteria 1886
10 Ga0070714_100191243 3300005435 Bacteria 1868
11 Ga0070714_100381561 3300005435 Bacteria 1329
12 Ga0070700_100025382 3300005441 Archaea 3488
13 Ga0070708_100013826 3300005445 Bacteria 6626
14 Ga0070708_100059684 3300005445 Bacteria 3401
15 Ga0070708_100527442 3300005445 Bacteria 1114
16 Ga0068867_100061710 3300005459 Bacteria 2784
17 Ga0070685_10052308 3300005466 Bacteria 2363
18 Ga0070706_100000027 3300005467 Bacteria 156057
19 Ga0070706_100044081 3300005467 Bacteria 4121
20 Ga0070707_100000112 3300005468 Bacteria 75211
21 Ga0070707_100004469 3300005468 Bacteria 13098
22 Ga0070707_100083556 3300005468 Bacteria 3085
23 Ga0070707_100116078 3300005468 Bacteria 2598
24 Ga0070698_100000059 3300005471 Bacteria 78871
25 Ga0070698_100002108 3300005471 Bacteria 22100
26 Ga0070698_100095497 3300005471 Bacteria 2950
27 Ga0070698_100228893 3300005471 Bacteria 1792
28 Ga0070699_100001726 3300005518 Bacteria 19925
29 Ga0070699_100030188 3300005518 Bacteria 4679
30 Ga0070697_100000005 3300005536 Bacteria 259746
31 Ga0070697_100002078 3300005536 Bacteria 15308
32 Ga0070697_100048981 3300005536 Bacteria 3427
33 Ga0070672_100488521 3300005543 Bacteria 1064
34 Ga0070695_100147581 3300005545 Bacteria 1638
35 Ga0070665_100087024 3300005548 Bacteria 3130
36 Ga0070664_100035957 3300005564 Bacteria 4160
37 Ga0068857_100003668 3300005577 Bacteria 12865
38 Ga0068856_100086459 3300005614 Bacteria 3115
39 Ga0068859_100066150 3300005617 Bacteria 3649
40 Ga0068861_100145895 3300005719 Bacteria 1937
41 Ga0068870_10099467 3300005840 Unclassified 1641
42 Ga0068863_100054522 3300005841 Bacteria 3788
43 Ga0068858_100190039 3300005842 Bacteria 1940
44 Ga0081455_10188100 3300005937 Unclassified 1558
45 Ga0081538_10021550 3300005981 Bacteria 4697
46 Ga0081538_10042825 3300005981 Unclassified 2851
47 Ga0081538_10065644 3300005981 Bacteria 2042
48 Ga0075428_100021916 3300006844 Bacteria 7075
49 Ga0075430_100011330 3300006846 Bacteria 7563
50 Ga0075430_100014727 3300006846 Archaea 6662
51 Ga0075431_100020781 3300006847 Archaea 6709
52 Ga0075433_10059470 3300006852 Bacteria 3343
53 Ga0068865_100238314 3300006881 Bacteria 1430
54 Ga0097620_100066149 3300006931 Bacteria 3649
55 Ga0075435_100211630 3300007076 Bacteria 1645
56 Ga0105244_10035689 3300009036 Bacteria 2611
57 Ga0111539_10000004 3300009094 Bacteria 751278
58 Ga0105242_10014707 3300009176 Bacteria 6059
59 Ga0105248_10049672 3300009177 Bacteria 4704
60 Ga0105248_10203350 3300009177 Bacteria 2232
61 Ga0105249_10078099 3300009553 Archaea 3071
62 Ga0157378_10024689 3300013297 Bacteria 5292
63 Ga0157375_10001120 3300013308 Bacteria 23192
64 Ga0157375_10123042 3300013308 Bacteria 2706
65 Ga0157377_10011189 3300014745 Archaea 4471
66 Ga0157379_10018024 3300014968 Bacteria 6223
67 Ga0157376_10012681 3300014969 Bacteria 6267
68 Ga0197907_10256504 3300020069 Bacteria 2139
69 Ga0206356_10348111 3300020070 Bacteria 3080
70 Ga0206349_1125241 3300020075 Archaea 3408
71 Ga0206351_10710262 3300020077 Archaea 3450
72 Ga0206350_10937845 3300020080 Archaea 3458
73 Ga0206353_11373141 3300020082 Archaea 3376
74 Ga0224712_10002716 3300022467 Archaea 4442
75 Ga0207655_1068778 3300025728 Bacteria 1326
76 Ga0207688_10049921 3300025901 Archaea 2340
77 Ga0207680_10047305 3300025903 Bacteria 2548
78 Ga0207643_10065239 3300025908 Archaea 2085
79 Ga0207643_10260719 3300025908 Bacteria 1070
80 Ga0207684_10000007 3300025910 Bacteria 612969
81 Ga0207684_10000015 3300025910 Bacteria 427232
82 Ga0207684_10004949 3300025910 Bacteria 12433
83 Ga0207684_10063422 3300025910 Bacteria 3137
84 Ga0207660_10241614 3300025917 Bacteria 1423
85 Ga0207662_10076091 3300025918 Bacteria 2040
86 Ga0207646_10000059 3300025922 Bacteria 154875
87 Ga0207646_10000069 3300025922 Bacteria 143056
88 Ga0207646_10001650 3300025922 Bacteria 27290
89 Ga0207646_10073621 3300025922 Bacteria 3051
90 Ga0207646_10114715 3300025922 Unclassified 2419
91 Ga0207659_10000002 3300025926 Bacteria 619441
92 Ga0207664_10197975 3300025929 Bacteria 1733
93 Ga0207686_10005343 3300025934 Bacteria 6888
94 Ga0207704_10203891 3300025938 Bacteria 1450
95 Ga0207691_10191418 3300025940 Bacteria 1784
96 Ga0207689_10278692 3300025942 Bacteria 1385
97 Ga0207679_10109122 3300025945 Bacteria 2180
98 Ga0207712_10317041 3300025961 Archaea 1285
99 Ga0207708_10043601 3300026075 Archaea 3419
100 Ga0207641_10009409 3300026088 Bacteria 8051
101 Ga0207648_10022874 3300026089 Bacteria 5607
102 Ga0207674_10007484 3300026116 Bacteria 12729
103 Ga0207675_100162403 3300026118 Bacteria 2132
104 Ga0209969_1003217 3300027360 Archaea 2255
105 Ga0209999_1025982 3300027543 Archaea 1082
106 Ga0209966_1009786 3300027695 Archaea 1717
107 Ga0207428_10000006 3300027907 Bacteria 491716
108 Ga0207428_10031895 3300027907 Archaea 4339
109 Ga0207428_10258837 3300027907 Archaea 1296
110 Ga0265332_10028882 3300031238 Unclassified 2426
111 Ga0265328_10009630 3300031239 Bacteria 3927
112 Ga0316575_10000185 3300031665 Bacteria 16288
113 Ga0316575_10007377 3300031665 Bacteria 3980
114 Ga0316575_10013209 3300031665 Bacteria 3081
115 Ga0316579_10005140 3300031691 Bacteria 5256
116 Ga0316579_10050101 3300031691 Bacteria 1952
117 Ga0316576_10019522 3300031727 Bacteria 4646
118 Ga0316578_10012531 3300031728 Bacteria 4474
119 Ga0316578_10116901 3300031728 Unclassified 1602
120 Ga0316577_10023969 3300031733 Bacteria 3390
121 Ga0316583_10000453 3300032133 Bacteria 12104
122 Ga0316585_10001909 3300032137 Bacteria 5563
123 Ga0316580_10048051 3300032139 Bacteria 1315
124 Ga0373941_0003449 3300035115 Bacteria 3580
125 Ga0373945_0028484 3300035116 Bacteria 1957
126 Ga0373956_0164877 3300035119 Bacteria 1045
127 Ga0373935_0037313 3300035692 Bacteria 3041
128 Ga0373933_0169250 3300035724 Bacteria 1390
129 Ga0373947_0033588 3300035725 Bacteria 3030
130 Ga0373937_0004656 3300036401 Bacteria 11652
131 Ga0373937_0066393 3300036401 Bacteria 3322
132 Ga0373937_0177246 3300036401 Bacteria 2001
133 Ga0316582_0000893 3300036647 Bacteria 12230
134 Ga0316582_0005585 3300036647 Bacteria 6501
135 Ga0316582_0014333 3300036647 Bacteria 4495
136 Ga0316584_0003260 3300036712 Bacteria 10500
137 Ga0316584_0020089 3300036712 Unclassified 4837
138 Ga0316584_0113334 3300036712 Unclassified 2029
139 Ga0316584_0207533 3300036712 Bacteria 1443
140 Ga0316581_0039982 3300037588 Bacteria 1428
141 Ga0439460_0002544 3300042461 Archaea 4396
142 Ga0451577_0000958 3300042876 Bacteria 42272
143 Ga0451577_0444382 3300042876 Bacteria 1177
144 Ga0453684_0005474 3300044712 Bacteria 25128
145 Ga0453684_0146750 3300044712 Bacteria 2809
146 Ga0451576_1274393 3300045051 Bacteria 766
147 Ga0495603_0088698 3300046455 Bacteria 1810
148 Ga0495629_0055735 3300046459 Bacteria 2764
149 Ga0495629_0313563 3300046459 Bacteria 1073
150 Ga0495580_0009435 3300046472 Bacteria 7677
151 Ga0495580_0062198 3300046472 Bacteria 2620
152 Ga0495580_0165240 3300046472 Bacteria 1531
153 Ga0495580_0197812 3300046472 Bacteria 1386
154 Ga0495580_0248082 3300046472 Bacteria 1219
155 Ga0495662_0028965 3300046476 Bacteria 2674
156 Ga0495665_0218252 3300046531 Bacteria 986
157 Ga0495586_0083464 3300046535 Bacteria 1758
158 Ga0495634_0083679 3300046642 Bacteria 2082
159 Ga0495635_0065436 3300046663 Bacteria 2494
160 Ga0495657_0248860 3300046675 Bacteria 1071
161 Ga0495623_0149298 3300046679 Bacteria 1383
162 Ga0495647_0003090 3300046681 Bacteria 5318
163 Ga0495647_0036591 3300046681 Bacteria 1848
164 Ga0495647_0078250 3300046681 Bacteria 1336
165 Ga0495658_0051910 3300046683 Bacteria 2323
166 Ga0495658_0184842 3300046683 Bacteria 1294
167 Ga0495613_0090681 3300046689 Bacteria 2214
168 Ga0495674_0098914 3300047319 Bacteria 2484
169 Ga0495684_0018330 3300047471 Bacteria 5396
170 Ga0495602_0024107 3300048088 Bacteria 5907
171 Ga0496109_0264722 3300048912 Bacteria 1620
172 Ga0496111_0081999 3300048914 Bacteria 2355
173 Ga0501306_010273 3300049127 Archaea 1175
174 Ga0501296_010845 3300049519 Archaea 1085
175 Ga0501319_002068 3300049535 Archaea 1240
176 Ga0501031_0064550 3300049568 Archaea 2384
177 Ga0501032_0007536 3300049569 Archaea 7951
178 Ga0501034_0033891 3300049571 Archaea 5177
179 Ga0501036_0007018 3300049572 Archaea 9168
180 Ga0501037_0137658 3300049573 Archaea 1748
181 Ga0501038_0016950 3300049574 Archaea 6591
182 Ga0501039_0005597 3300049575 Archaea 9509
183 Ga0501040_0005278 3300049576 Archaea 8354
184 Ga0501041_0076252 3300049577 Archaea 2062
185 Ga0501042_0006521 3300049578 Archaea 7581
186 Ga0501042_0071756 3300049578 Archaea 2478
187 Ga0501043_0052916 3300049579 Archaea 3188
188 Ga0501046_0021069 3300049580 Archaea 5382
189 Ga0501046_0186766 3300049580 Archaea 1548
190 Ga0501046_0370131 3300049580 Archaea 1038
191 Ga0501047_0105543 3300049581 Archaea 2697
192 Ga0501048_0015096 3300049582 Archaea 5708
193 Ga0501071_0002032 3300049587 Archaea 12106
194 Ga0501073_0000393 3300049589 Bacteria 29670
195 Ga0501074_0147395 3300049590 Archaea 1683
196 Ga0501075_0038584 3300049591 Archaea 3571
197 Ga0501076_0015489 3300049592 Archaea 5763
198 Ga0501077_0021359 3300049593 Archaea 4096
199 Ga0501214_000507 3300049659 Archaea 2623
200 Ga0501233_015967 3300049668 Archaea 1552
201 Ga0501261_016792 3300049690 Archaea 1018
202 Ga0501079_0028351 3300049741 Archaea 4295
203 Ga0501080_0005260 3300049742 Archaea 11526
204 Ga0501081_0042546 3300049743 Archaea 3113
205 Ga0501083_0070418 3300049744 Archaea 2326
206 Ga0501083_0147447 3300049744 Bacteria 1541
207 Ga0501035_0041532 3300049822 Archaea 4152
208 Ga0501044_0039191 3300049823 Archaea 4943
209 Ga0501045_0003142 3300049824 Archaea 11297
210 nmdc:mga05p37_23915_c1 3300050507 Archaea 7419
211 nmdc:mga09592_8556_c1 3300050508 Archaea 8323
212 nmdc:mga0qj67_10342_c1 3300050509 Bacteria 6970
213 nmdc:mga0qj67_412384_c1 3300050509 Archaea 1090
214 nmdc:mga06r32_18245_c1 3300050510 Archaea 6422
215 nmdc:mga08y16_5_c1 3300050511 Bacteria 751284
216 nmdc:mga08y16_76831_c1 3300050511 Archaea 3481
217 nmdc:mga0rr50_186729_c1 3300050513 Bacteria 1697
218 Ga0495612_0081688 3300053078 Bacteria 1358
219 Ga0501084_0005655 3300054114 Archaea 10263
220 Ga0501084_0277702 3300054114 Bacteria 1415
221 Ga0501082_0016214 3300060353 Archaea 6414
222 Ga0316581_0001675
223 Ga0058862_10122562
224 Ga0070690_100118287
225 Ga0070687_100059711
226 Ga0070675_100000026
227 Ga0070673_100294293
228 Ga0070673_100343986
229 Ga0070659_100214241
230 Ga0070667_100176827
231 Ga0070714_100191243
232 Ga0070714_100381561
233 Ga0070700_100025382
234 Ga0070708_100013826
235 Ga0070708_100059684
236 Ga0070708_100527442
237 Ga0068867_100061710
238 Ga0070685_10052308
239 Ga0070706_100000027
240 Ga0070706_100044081
241 Ga0070707_100000112
242 Ga0070707_100004469
243 Ga0070707_100083556
244 Ga0070707_100116078
245 Ga0070698_100000059
246 Ga0070698_100002108
247 Ga0070698_100095497
248 Ga0070698_100228893
249 Ga0070699_100001726
250 Ga0070699_100030188
251 Ga0070697_100000005
252 Ga0070697_100002078
253 Ga0070697_100048981
254 Ga0070672_100488521
255 Ga0070695_100147581
256 Ga0070665_100087024
257 Ga0070664_100035957
258 Ga0068857_100003668
259 Ga0068856_100086459
260 Ga0068859_100066150
261 Ga0068861_100145895
262 Ga0068870_10099467
263 Ga0068863_100054522
264 Ga0068858_100190039
265 Ga0081455_10188100
266 Ga0081538_10021550
267 Ga0081538_10042825
268 Ga0081538_10065644
269 Ga0075428_100021916
270 Ga0075430_100011330
271 Ga0075430_100014727
272 Ga0075431_100020781
273 Ga0075433_10059470
274 Ga0068865_100238314
275 Ga0097620_100066149
276 Ga0075435_100211630
277 Ga0105244_10035689
278 Ga0111539_10000004
279 Ga0105242_10014707
280 Ga0105248_10049672
281 Ga0105248_10203350
282 Ga0105249_10078099
283 Ga0157378_10024689
284 Ga0157375_10001120
285 Ga0157375_10123042
286 Ga0157377_10011189
287 Ga0157379_10018024
288 Ga0157376_10012681
289 Ga0197907_10256504
290 Ga0206356_10348111
291 Ga0206349_1125241
292 Ga0206351_10710262
293 Ga0206350_10937845
294 Ga0206353_11373141
295 Ga0224712_10002716
296 Ga0207655_1068778
297 Ga0207688_10049921
298 Ga0207680_10047305
299 Ga0207643_10065239
300 Ga0207643_10260719
301 Ga0207684_10000007
302 Ga0207684_10000015
303 Ga0207684_10004949
304 Ga0207684_10063422
305 Ga0207660_10241614
306 Ga0207662_10076091
307 Ga0207646_10000059
308 Ga0207646_10000069
309 Ga0207646_10001650
310 Ga0207646_10073621
311 Ga0207646_10114715
312 Ga0207659_10000002
313 Ga0207664_10197975
314 Ga0207686_10005343
315 Ga0207704_10203891
316 Ga0207691_10191418
317 Ga0207689_10278692
318 Ga0207679_10109122
319 Ga0207712_10317041
320 Ga0207708_10043601
321 Ga0207641_10009409
322 Ga0207648_10022874
323 Ga0207674_10007484
324 Ga0207675_100162403
325 Ga0209969_1003217
326 Ga0209999_1025982
327 Ga0209966_1009786
328 Ga0207428_10000006
329 Ga0207428_10031895
330 Ga0207428_10258837
331 Ga0265332_10028882
332 Ga0265328_10009630
333 Ga0316575_10000185
334 Ga0316575_10007377
335 Ga0316575_10013209
336 Ga0316579_10005140
337 Ga0316579_10050101
338 Ga0316576_10019522
339 Ga0316578_10012531
340 Ga0316578_10116901
341 Ga0316577_10023969
342 Ga0316583_10000453
343 Ga0316585_10001909
344 Ga0316580_10048051
345 Ga0373941_0003449
346 Ga0373945_0028484
347 Ga0373956_0164877
348 Ga0373935_0037313
349 Ga0373933_0169250
350 Ga0373947_0033588
351 Ga0373937_0004656
352 Ga0373937_0066393
353 Ga0373937_0177246
354 Ga0316582_0000893
355 Ga0316582_0005585
356 Ga0316582_0014333
357 Ga0316584_0003260
358 Ga0316584_0020089
359 Ga0316584_0113334
360 Ga0316584_0207533
361 Ga0316581_0039982
362 Ga0439460_0002544
363 Ga0451577_0000958
364 Ga0451577_0444382
365 Ga0453684_0005474
366 Ga0453684_0146750
367 Ga0451576_1274393
368 Ga0495603_0088698
369 Ga0495629_0055735
370 Ga0495629_0313563
371 Ga0495580_0009435
372 Ga0495580_0062198
373 Ga0495580_0165240
374 Ga0495580_0197812
375 Ga0495580_0248082
376 Ga0495662_0028965
377 Ga0495665_0218252
378 Ga0495586_0083464
379 Ga0495634_0083679
380 Ga0495635_0065436
381 Ga0495657_0248860
382 Ga0495623_0149298
383 Ga0495647_0003090
384 Ga0495647_0036591
385 Ga0495647_0078250
386 Ga0495658_0051910
387 Ga0495658_0184842
388 Ga0495613_0090681
389 Ga0495674_0098914
390 Ga0495684_0018330
391 Ga0495602_0024107
392 Ga0496109_0264722
393 Ga0496111_0081999
394 Ga0501306_010273
395 Ga0501296_010845
396 Ga0501319_002068
397 Ga0501031_0064550
398 Ga0501032_0007536
399 Ga0501034_0033891
400 Ga0501036_0007018
401 Ga0501037_0137658
402 Ga0501038_0016950
403 Ga0501039_0005597
404 Ga0501040_0005278
405 Ga0501041_0076252
406 Ga0501042_0006521
407 Ga0501042_0071756
408 Ga0501043_0052916
409 Ga0501046_0021069
410 Ga0501046_0186766
411 Ga0501046_0370131
412 Ga0501047_0105543
413 Ga0501048_0015096
414 Ga0501071_0002032
415 Ga0501073_0000393
416 Ga0501074_0147395
417 Ga0501075_0038584
418 Ga0501076_0015489
419 Ga0501077_0021359
420 Ga0501214_000507
421 Ga0501233_015967
422 Ga0501261_016792
423 Ga0501079_0028351
424 Ga0501080_0005260
425 Ga0501081_0042546
426 Ga0501083_0070418
427 Ga0501083_0147447
428 Ga0501035_0041532
429 Ga0501044_0039191
430 Ga0501045_0003142
431 nmdc:mga05p37_23915_c1
432 nmdc:mga09592_8556_c1
433 nmdc:mga0qj67_10342_c1
434 nmdc:mga0qj67_412384_c1
435 nmdc:mga06r32_18245_c1
436 nmdc:mga08y16_5_c1
437 nmdc:mga08y16_76831_c1
438 nmdc:mga0rr50_186729_c1
439 Ga0495612_0081688
440 Ga0501084_0005655
441 Ga0501084_0277702
442 Ga0501082_0016214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12367

PFO_beta_C

Pyruvate ferredoxin oxidoreductase beta subunit C terminal

212

299

0.94

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

53

208

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b48-assembly1.cif.gz_B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai 0.8518 10 310
5b46-assembly1.cif.gz_B-2 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form 0.8505 9 311
5b48-assembly1.cif.gz_B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai 0.849 10 310
5b46-assembly1.cif.gz_B-2 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form 0.8478 9 311
5b47-assembly1.cif.gz_B-2 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex 0.8413 13 311
ID Description Score Start End Superfamily
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8603 72 202 3.40.50.970
af_O53181_117_260_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.84 80 195 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.7528 72 202 3.40.50.970
3itkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.734 38 90 3.40.50.720
1jscA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.7085 21 189 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A430RP78-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9902 1 89 GO:0016625
GO:0030976
AF-A0A7V4ANL1-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9888 1 87 GO:0016625
GO:0030976
AF-A0A2T4RMS4-F1-model_v4 deleted 0.9863 3 89
AF-X0T661-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9861 3 89 GO:0016625
GO:0030976
AF-A0A534L463-F1-model_v4 2-oxoacid ferredoxin oxidoreductase 0.9856 1 89 GO:0006082
GO:0016625
GO:0030976
GO:0044272

Map