F333590

General Info

Members Datasets Scaffolds Average Seq Length
221 143 442 145

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0111919|Ga0395898_0111919_1910_2395
Length 161
Sequence LRKSRTNDTVHTEPAAVPKEGEADTRAIRLTIPAKAEYITLGRLALTGLSRLRPLGEETLADLKLALTEACSNSVRHAYREGEGAVEILYELHGDRLAIEVADDGEGFAVGLSGDPEDELVEGGLGIAIIKAIADEFELGPRTEGRGSRLRFVKLLPEASS

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
58 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
68 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
73 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
74 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
77 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
78 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
79 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
80 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
81 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
82 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
83 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
84 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
85 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
86 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
87 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
90 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.93
Metatranscriptomes 4.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 1.81
Rhizosphere 97.29
Stem 0
Stem Tuber 0
Unclassified 15.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0111919 3300037466 Bacteria 2616
2 JGI24747J21853_1029518 3300001978 Unclassified 623
3 JGI25407J50210_10001007 3300003373 Bacteria 6137
4 JGI25407J50210_10002256 3300003373 Bacteria 4518
5 JGI25405J52794_10070820 3300003911 Unclassified 761
6 Ga0070683_100005050 3300005329 Bacteria 10955
7 Ga0070683_100151605 3300005329 Bacteria 2198
8 Ga0070683_101165933 3300005329 Archaea 740
9 Ga0070660_100693171 3300005339 Bacteria 854
10 Ga0070714_101257094 3300005435 Bacteria 722
11 Ga0070710_10349089 3300005437 Unclassified 979
12 Ga0070708_100466356 3300005445 Bacteria 1191
13 Ga0070662_100297156 3300005457 Bacteria 1311
14 Ga0070706_100068363 3300005467 Bacteria 3285
15 Ga0070707_101030930 3300005468 Bacteria 788
16 Ga0070707_101425922 3300005468 Bacteria 659
17 Ga0070698_100000853 3300005471 Bacteria 33433
18 Ga0070699_100474149 3300005518 Bacteria 1136
19 Ga0070684_100020397 3300005535 Bacteria 5499
20 Ga0070684_101552200 3300005535 Unclassified 624
21 Ga0070697_100845692 3300005536 Bacteria 811
22 Ga0070697_101011343 3300005536 Unclassified 739
23 Ga0070693_100054161 3300005547 Unclassified 2306
24 Ga0068855_100032465 3300005563 Bacteria 6234
25 Ga0068855_100208068 3300005563 Bacteria 2200
26 Ga0070664_100370545 3300005564 Bacteria 1305
27 Ga0068857_100121822 3300005577 Bacteria 2349
28 Ga0081455_10006731 3300005937 Bacteria 12272
29 Ga0081455_10015180 3300005937 Bacteria 7494
30 Ga0081538_10000094 3300005981 Bacteria 86715
31 Ga0081538_10000100 3300005981 Bacteria 83917
32 Ga0081538_10055787 3300005981 Bacteria 2321
33 Ga0081538_10084616 3300005981 Bacteria 1670
34 Ga0081538_10161787 3300005981 Unclassified 993
35 Ga0081539_10001005 3300005985 Bacteria 52334
36 Ga0075364_10891371 3300006051 Unclassified 606
37 Ga0075430_100132794 3300006846 Bacteria 2075
38 Ga0075431_100414566 3300006847 Bacteria 1347
39 Ga0075433_10301574 3300006852 Bacteria 1419
40 Ga0075434_100673731 3300006871 Bacteria 1052
41 Ga0105240_10102621 3300009093 Bacteria 3476
42 Ga0114129_10058674 3300009147 Bacteria 5383
43 Ga0114129_10143581 3300009147 Bacteria 3270
44 Ga0114129_11728060 3300009147 Bacteria 763
45 Ga0157369_10014160 3300013105 Bacteria 9011
46 Ga0157369_10089626 3300013105 Bacteria 3284
47 Ga0182008_10043498 3300014497 Bacteria 2236
48 Ga0206356_10031006 3300020070 Unclassified 1436
49 Ga0206356_10989706 3300020070 Bacteria 864
50 Ga0206349_1158308 3300020075 Bacteria 794
51 Ga0206352_10890285 3300020078 Bacteria 613
52 Ga0206354_10137273 3300020081 Bacteria 1004
53 Ga0206353_10276594 3300020082 Bacteria 1413
54 Ga0206353_11872767 3300020082 Bacteria 1679
55 Ga0154015_1605410 3300020610 Bacteria 514
56 Ga0207692_10527273 3300025898 Unclassified 752
57 Ga0207705_10555685 3300025909 Bacteria 892
58 Ga0207684_10055999 3300025910 Bacteria 3345
59 Ga0207657_10062273 3300025919 Bacteria 3195
60 Ga0207646_10891534 3300025922 Bacteria 789
61 Ga0207661_10003288 3300025944 Bacteria 11218
62 Ga0207661_10148393 3300025944 Bacteria 2025
63 Ga0207667_10426924 3300025949 Unclassified 1348
64 Ga0207674_10061602 3300026116 Bacteria 3791
65 Ga0207683_10487637 3300026121 Unclassified 1138
66 Ga0307408_100290844 3300031548 Bacteria 1364
67 Ga0307408_100351221 3300031548 Unclassified 1251
68 Ga0307405_10084355 3300031731 Bacteria 2085
69 Ga0307413_10002593 3300031824 Bacteria 7391
70 Ga0307406_10214760 3300031901 Unclassified 1425
71 Ga0307407_10113945 3300031903 Unclassified 1702
72 Ga0307409_100075742 3300031995 Bacteria 2695
73 Ga0307409_100168071 3300031995 Bacteria 1927
74 Ga0307416_100066570 3300032002 Bacteria 2966
75 Ga0307416_100464747 3300032002 Unclassified 1321
76 Ga0307411_10319895 3300032005 Unclassified 1252
77 Ga0307415_100151776 3300032126 Bacteria 1784
78 Ga0307415_100214065 3300032126 Unclassified 1539
79 Ga0373945_0247685 3300035116 Unclassified 752
80 Ga0373943_0160209 3300035170 Archaea 1225
81 Ga0373947_0549368 3300035725 Bacteria 786
82 Ga0373925_0048964 3300037068 Bacteria 3150
83 Ga0373925_0244173 3300037068 Bacteria 1439
84 Ga0395899_0009060 3300037312 Bacteria 7649
85 Ga0395899_0056525 3300037312 Bacteria 2900
86 Ga0395899_0063539 3300037312 Bacteria 2716
87 Ga0395899_0141226 3300037312 Bacteria 1713
88 Ga0395900_0004351 3300037418 Bacteria 15029
89 Ga0395900_0004452 3300037418 Bacteria 14842
90 Ga0395900_0046365 3300037418 Bacteria 4475
91 Ga0395900_0234403 3300037418 Bacteria 1844
92 Ga0395900_0325330 3300037418 Bacteria 1517
93 Ga0395900_0503321 3300037418 Bacteria 1161
94 Ga0395898_0008367 3300037466 Bacteria 10937
95 Ga0395898_0013289 3300037466 Bacteria 8479
96 Ga0395898_0018689 3300037466 Bacteria 7065
97 Ga0395898_0022958 3300037466 Bacteria 6308
98 Ga0395898_0329756 3300037466 Bacteria 1455
99 Ga0395898_0388926 3300037466 Bacteria 1330
100 Ga0395898_0446537 3300037466 Bacteria 1232
101 Ga0395898_0762272 3300037466 Archaea 909
102 Ga0395905_0005311 3300037471 Bacteria 13168
103 Ga0395905_0006743 3300037471 Bacteria 11501
104 Ga0395905_0014066 3300037471 Bacteria 7651
105 Ga0395905_0025045 3300037471 Bacteria 5628
106 Ga0395905_0031568 3300037471 Bacteria 4986
107 Ga0395905_0606343 3300037471 Bacteria 997
108 Ga0395905_1415775 3300037471 Archaea 599
109 Ga0395901_0002692 3300038443 Bacteria 17910
110 Ga0395901_0009736 3300038443 Bacteria 9743
111 Ga0395901_0012258 3300038443 Bacteria 8701
112 Ga0395901_0099239 3300038443 Bacteria 3053
113 Ga0395901_0115027 3300038443 Unclassified 2825
114 Ga0395901_0423867 3300038443 Bacteria 1364
115 Ga0395901_1290554 3300038443 Bacteria 692
116 Ga0395901_1653420 3300038443 Bacteria 593
117 Ga0451802_0648088 3300041460 Bacteria 925
118 Ga0451853_3820495 3300041512 Bacteria 568
119 Ga0439458_0051847 3300042157 Unclassified 1014
120 Ga0439440_0022672 3300042993 Bacteria 1425
121 Ga0439440_0247583 3300042993 Unclassified 542
122 Ga0466963_0959488 3300044694 Unclassified 602
123 Ga0466968_0149545 3300044735 Unclassified 1073
124 Ga0466967_1052913 3300045976 Unclassified 810
125 Ga0495584_0155074 3300046491 Bacteria 1163
126 Ga0495607_0197122 3300046501 Bacteria 999
127 Ga0495583_0099456 3300046506 Bacteria 1243
128 Ga0495630_0028327 3300046517 Bacteria 4163
129 Ga0495631_0165042 3300046518 Bacteria 950
130 Ga0495644_0038011 3300046523 Unclassified 1816
131 Ga0495663_0023577 3300046525 Bacteria 1783
132 Ga0495666_0075179 3300046526 Bacteria 1602
133 Ga0495642_0009940 3300046528 Bacteria 3644
134 Ga0495642_0049378 3300046528 Bacteria 1728
135 Ga0495665_0041859 3300046531 Bacteria 2438
136 Ga0495621_0253358 3300046539 Bacteria 720
137 Ga0495656_0104746 3300046615 Bacteria 1314
138 Ga0495668_0039464 3300046616 Bacteria 2636
139 Ga0495659_0005028 3300046664 Bacteria 4157
140 Ga0495588_0128913 3300046674 Bacteria 1334
141 Ga0495669_0057406 3300046684 Unclassified 1756
142 Ga0495613_0402061 3300046689 Bacteria 934
143 Ga0495671_0254509 3300046692 Bacteria 847
144 Ga0495589_0226037 3300046794 Bacteria 878
145 Ga0495660_0091981 3300046810 Bacteria 1575
146 Ga0495581_0028812 3300047315 Bacteria 3219
147 Ga0495636_0091334 3300047318 Bacteria 1322
148 Ga0495676_0118506 3300047321 Bacteria 1930
149 Ga0495676_0487390 3300047321 Bacteria 810
150 Ga0495677_0036447 3300047445 Unclassified 1797
151 Ga0496101_0312252 3300048904 Bacteria 1233
152 Ga0496111_0553491 3300048914 Bacteria 844
153 Ga0496112_0000205 3300048915 Bacteria 38846
154 Ga0501031_0002323 3300049568 Bacteria 12041
155 Ga0501032_0001554 3300049569 Bacteria 18314
156 Ga0501033_0000899 3300049570 Bacteria 27196
157 Ga0501034_0105164 3300049571 Bacteria 2816
158 Ga0501036_0056561 3300049572 Bacteria 3323
159 Ga0501037_0001104 3300049573 Bacteria 19985
160 Ga0501038_0003802 3300049574 Bacteria 14046
161 Ga0501039_0006599 3300049575 Bacteria 8814
162 Ga0501039_0211073 3300049575 Bacteria 1527
163 Ga0501040_0025587 3300049576 Bacteria 3968
164 Ga0501040_0224435 3300049576 Bacteria 1337
165 Ga0501040_0282044 3300049576 Bacteria 1186
166 Ga0501040_1303595 3300049576 Unclassified 527
167 Ga0501041_0136094 3300049577 Bacteria 1531
168 Ga0501042_0000930 3300049578 Bacteria 16501
169 Ga0501042_0081770 3300049578 Bacteria 2315
170 Ga0501043_0000693 3300049579 Bacteria 29791
171 Ga0501043_0184659 3300049579 Bacteria 1624
172 Ga0501046_0001855 3300049580 Bacteria 20125
173 Ga0501047_0120577 3300049581 Bacteria 2505
174 Ga0501048_0002297 3300049582 Bacteria 14588
175 Ga0501048_0092002 3300049582 Bacteria 2139
176 Ga0501068_0001514 3300049584 Bacteria 12364
177 Ga0501069_0014588 3300049585 Bacteria 4201
178 Ga0501070_0003573 3300049586 Bacteria 13450
179 Ga0501070_0117406 3300049586 Bacteria 2198
180 Ga0501071_0027142 3300049587 Bacteria 4026
181 Ga0501071_0059972 3300049587 Bacteria 2753
182 Ga0501072_0013190 3300049588 Bacteria 6328
183 Ga0501072_0103200 3300049588 Bacteria 2266
184 Ga0501073_0056408 3300049589 Bacteria 2748
185 Ga0501074_0006066 3300049590 Bacteria 8723
186 Ga0501074_0120561 3300049590 Bacteria 1876
187 Ga0501074_0659151 3300049590 Bacteria 739
188 Ga0501075_0017085 3300049591 Bacteria 5236
189 Ga0501076_0012435 3300049592 Bacteria 6362
190 Ga0501076_0413545 3300049592 Bacteria 1109
191 Ga0501077_0007499 3300049593 Bacteria 6730
192 Ga0501217_037832 3300049661 Unclassified 1217
193 Ga0501079_0008837 3300049741 Bacteria 7627
194 Ga0501079_0287066 3300049741 Unclassified 1287
195 Ga0501079_1126844 3300049741 Unclassified 618
196 Ga0501080_0016416 3300049742 Bacteria 6837
197 Ga0501080_0091878 3300049742 Bacteria 2819
198 Ga0501081_0054850 3300049743 Bacteria 2753
199 Ga0501081_0056305 3300049743 Bacteria 2717
200 Ga0501083_0002444 3300049744 Bacteria 12712
201 Ga0501035_0001594 3300049822 Bacteria 22969
202 Ga0501044_0032672 3300049823 Bacteria 5470
203 Ga0501044_0265819 3300049823 Bacteria 1653
204 Ga0501045_0010241 3300049824 Bacteria 6564
205 Ga0501045_0497505 3300049824 Bacteria 905
206 nmdc:mga05p37_1232886_c1 3300050507 Bacteria 769
207 nmdc:mga05p37_124780_c1 3300050507 Bacteria 3162
208 nmdc:mga0qj67_134144_c1 3300050509 Bacteria 2006
209 nmdc:mga06r32_413247_c1 3300050510 Bacteria 1331
210 nmdc:mga08y16_1967489_c1 3300050511 Bacteria 534
211 nmdc:mga0n895_264215_c1 3300050512 Bacteria 1746
212 nmdc:mga0a205_286928_c1 3300050515 Bacteria 1521
213 Ga0495655_0094983 3300053083 Bacteria 874
214 Ga0501084_0047239 3300054114 Bacteria 3605
215 Ga0501084_1217346 3300054114 Unclassified 632
216 Ga0590075_041389 3300059424 Unclassified 1178
217 Ga0587073_0266777 3300059492 Bacteria 544
218 Ga0501082_0071182 3300060353 Bacteria 2994
219 Ga0501082_1223149 3300060353 Bacteria 656
220 Ga0530510_0009390 3300061734 Bacteria 6858
221 Ga0530510_0184592 3300061734 Bacteria 1547
222 Ga0395898_0111919
223 JGI24747J21853_1029518
224 JGI25407J50210_10001007
225 JGI25407J50210_10002256
226 JGI25405J52794_10070820
227 Ga0070683_100005050
228 Ga0070683_100151605
229 Ga0070683_101165933
230 Ga0070660_100693171
231 Ga0070714_101257094
232 Ga0070710_10349089
233 Ga0070708_100466356
234 Ga0070662_100297156
235 Ga0070706_100068363
236 Ga0070707_101030930
237 Ga0070707_101425922
238 Ga0070698_100000853
239 Ga0070699_100474149
240 Ga0070684_100020397
241 Ga0070684_101552200
242 Ga0070697_100845692
243 Ga0070697_101011343
244 Ga0070693_100054161
245 Ga0068855_100032465
246 Ga0068855_100208068
247 Ga0070664_100370545
248 Ga0068857_100121822
249 Ga0081455_10006731
250 Ga0081455_10015180
251 Ga0081538_10000094
252 Ga0081538_10000100
253 Ga0081538_10055787
254 Ga0081538_10084616
255 Ga0081538_10161787
256 Ga0081539_10001005
257 Ga0075364_10891371
258 Ga0075430_100132794
259 Ga0075431_100414566
260 Ga0075433_10301574
261 Ga0075434_100673731
262 Ga0105240_10102621
263 Ga0114129_10058674
264 Ga0114129_10143581
265 Ga0114129_11728060
266 Ga0157369_10014160
267 Ga0157369_10089626
268 Ga0182008_10043498
269 Ga0206356_10031006
270 Ga0206356_10989706
271 Ga0206349_1158308
272 Ga0206352_10890285
273 Ga0206354_10137273
274 Ga0206353_10276594
275 Ga0206353_11872767
276 Ga0154015_1605410
277 Ga0207692_10527273
278 Ga0207705_10555685
279 Ga0207684_10055999
280 Ga0207657_10062273
281 Ga0207646_10891534
282 Ga0207661_10003288
283 Ga0207661_10148393
284 Ga0207667_10426924
285 Ga0207674_10061602
286 Ga0207683_10487637
287 Ga0307408_100290844
288 Ga0307408_100351221
289 Ga0307405_10084355
290 Ga0307413_10002593
291 Ga0307406_10214760
292 Ga0307407_10113945
293 Ga0307409_100075742
294 Ga0307409_100168071
295 Ga0307416_100066570
296 Ga0307416_100464747
297 Ga0307411_10319895
298 Ga0307415_100151776
299 Ga0307415_100214065
300 Ga0373945_0247685
301 Ga0373943_0160209
302 Ga0373947_0549368
303 Ga0373925_0048964
304 Ga0373925_0244173
305 Ga0395899_0009060
306 Ga0395899_0056525
307 Ga0395899_0063539
308 Ga0395899_0141226
309 Ga0395900_0004351
310 Ga0395900_0004452
311 Ga0395900_0046365
312 Ga0395900_0234403
313 Ga0395900_0325330
314 Ga0395900_0503321
315 Ga0395898_0008367
316 Ga0395898_0013289
317 Ga0395898_0018689
318 Ga0395898_0022958
319 Ga0395898_0329756
320 Ga0395898_0388926
321 Ga0395898_0446537
322 Ga0395898_0762272
323 Ga0395905_0005311
324 Ga0395905_0006743
325 Ga0395905_0014066
326 Ga0395905_0025045
327 Ga0395905_0031568
328 Ga0395905_0606343
329 Ga0395905_1415775
330 Ga0395901_0002692
331 Ga0395901_0009736
332 Ga0395901_0012258
333 Ga0395901_0099239
334 Ga0395901_0115027
335 Ga0395901_0423867
336 Ga0395901_1290554
337 Ga0395901_1653420
338 Ga0451802_0648088
339 Ga0451853_3820495
340 Ga0439458_0051847
341 Ga0439440_0022672
342 Ga0439440_0247583
343 Ga0466963_0959488
344 Ga0466968_0149545
345 Ga0466967_1052913
346 Ga0495584_0155074
347 Ga0495607_0197122
348 Ga0495583_0099456
349 Ga0495630_0028327
350 Ga0495631_0165042
351 Ga0495644_0038011
352 Ga0495663_0023577
353 Ga0495666_0075179
354 Ga0495642_0009940
355 Ga0495642_0049378
356 Ga0495665_0041859
357 Ga0495621_0253358
358 Ga0495656_0104746
359 Ga0495668_0039464
360 Ga0495659_0005028
361 Ga0495588_0128913
362 Ga0495669_0057406
363 Ga0495613_0402061
364 Ga0495671_0254509
365 Ga0495589_0226037
366 Ga0495660_0091981
367 Ga0495581_0028812
368 Ga0495636_0091334
369 Ga0495676_0118506
370 Ga0495676_0487390
371 Ga0495677_0036447
372 Ga0496101_0312252
373 Ga0496111_0553491
374 Ga0496112_0000205
375 Ga0501031_0002323
376 Ga0501032_0001554
377 Ga0501033_0000899
378 Ga0501034_0105164
379 Ga0501036_0056561
380 Ga0501037_0001104
381 Ga0501038_0003802
382 Ga0501039_0006599
383 Ga0501039_0211073
384 Ga0501040_0025587
385 Ga0501040_0224435
386 Ga0501040_0282044
387 Ga0501040_1303595
388 Ga0501041_0136094
389 Ga0501042_0000930
390 Ga0501042_0081770
391 Ga0501043_0000693
392 Ga0501043_0184659
393 Ga0501046_0001855
394 Ga0501047_0120577
395 Ga0501048_0002297
396 Ga0501048_0092002
397 Ga0501068_0001514
398 Ga0501069_0014588
399 Ga0501070_0003573
400 Ga0501070_0117406
401 Ga0501071_0027142
402 Ga0501071_0059972
403 Ga0501072_0013190
404 Ga0501072_0103200
405 Ga0501073_0056408
406 Ga0501074_0006066
407 Ga0501074_0120561
408 Ga0501074_0659151
409 Ga0501075_0017085
410 Ga0501076_0012435
411 Ga0501076_0413545
412 Ga0501077_0007499
413 Ga0501217_037832
414 Ga0501079_0008837
415 Ga0501079_0287066
416 Ga0501079_1126844
417 Ga0501080_0016416
418 Ga0501080_0091878
419 Ga0501081_0054850
420 Ga0501081_0056305
421 Ga0501083_0002444
422 Ga0501035_0001594
423 Ga0501044_0032672
424 Ga0501044_0265819
425 Ga0501045_0010241
426 Ga0501045_0497505
427 nmdc:mga05p37_1232886_c1
428 nmdc:mga05p37_124780_c1
429 nmdc:mga0qj67_134144_c1
430 nmdc:mga06r32_413247_c1
431 nmdc:mga08y16_1967489_c1
432 nmdc:mga0n895_264215_c1
433 nmdc:mga0a205_286928_c1
434 Ga0495655_0094983
435 Ga0501084_0047239
436 Ga0501084_1217346
437 Ga0590075_041389
438 Ga0587073_0266777
439 Ga0501082_0071182
440 Ga0501082_1223149
441 Ga0530510_0009390
442 Ga0530510_0184592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

32

154

0.91

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

59

159

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9434 14 146
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9387 14 146
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9347 14 146
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.934 14 146
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9297 14 146
ID Description Score Start End Superfamily
3ke6B02 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8625 14 147 3.30.565.10
af_P9WLZ7_398_539_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8483 14 147 3.30.565.10
af_P76584_1_290_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8411 73 95 2.70.98.10
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8338 16 146 3.90.1100.10
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8213 16 146 3.90.1100.10
ID Description Score Start End GO Terms
AF-A0A537YVJ7-F1-model_v4 ATP-binding protein 0.9028 16 147 GO:0004674
GO:0005524
AF-A0A537YVJ7-F1-model_v4 ATP-binding protein 0.896 16 147 GO:0004674
GO:0005524
AF-A0A382M998-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.8901 12 99
AF-A0A538E643-F1-model_v4 ATP-binding protein 0.8887 12 146 GO:0004674
GO:0005524
AF-A0A7C1I9R5-F1-model_v4 ATP-binding protein 0.8877 5 146 GO:0004674
GO:0005524

Map