F333451

General Info

Members Datasets Scaffolds Average Seq Length
221 135 211 73

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10047207|Ga0207640_100472073
Length 83
Sequence MTEEGLARTMLEMRPDCERCGVDLPADEPGAFICSFECTYCASCAEALDDRCPNCGGELMDRPTRTGDALKRHLASAERRFRA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
5 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
6 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
7 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
8 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
9 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
10 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
11 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
72 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
92 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
93 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
94 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
114 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
115 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
116 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
117 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
118 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
121 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
127 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
128 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
129 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
130 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
131 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
132 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
133 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
134 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.48
Metatranscriptomes 0
Isolates 4.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.46
Nodule 1.81
Rhizoplane 3.62
Rhizosphere 71.04
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1267906 2162886007 Bacteria 1607
2 Ga0065704_10073598 3300005289 Bacteria 6970
3 Ga0065707_10485670 3300005295 Bacteria 769
4 Ga0070690_101544441 3300005330 Bacteria 537
5 Ga0070670_100261775 3300005331 Bacteria 1508
6 Ga0070660_101443370 3300005339 Bacteria 585
7 Ga0070669_100136542 3300005353 Bacteria 1887
8 Ga0070659_100979015 3300005366 Bacteria 742
9 Ga0070667_100001283 3300005367 Bacteria 22714
10 Ga0070667_101492410 3300005367 Bacteria 635
11 Ga0070705_100324594 3300005440 Bacteria 1113
12 Ga0070707_100663554 3300005468 Bacteria 1005
13 Ga0070679_101115225 3300005530 Bacteria 734
14 Ga0070672_101807150 3300005543 Bacteria 549
15 Ga0070665_100026073 3300005548 Bacteria 5886
16 Ga0068855_100095138 3300005563 Bacteria 3434
17 Ga0070664_100222085 3300005564 Bacteria 1691
18 Ga0068857_100014577 3300005577 Bacteria 6857
19 Ga0068854_100863370 3300005578 Bacteria 793
20 Ga0068864_100571408 3300005618 Bacteria 1095
21 Ga0068863_100581243 3300005841 Bacteria 1108
22 Ga0068858_100035259 3300005842 Bacteria 4641
23 Ga0068860_100000093 3300005843 Bacteria 150034
24 Ga0068860_100538214 3300005843 Bacteria 1169
25 Ga0068862_100059676 3300005844 Bacteria 3276
26 Ga0075365_10089525 3300006038 Bacteria 2095
27 Ga0075365_10222362 3300006038 Bacteria 1325
28 Ga0075368_10000289 3300006042 Bacteria 14434
29 Ga0075363_100030218 3300006048 Bacteria 2803
30 Ga0075363_100085483 3300006048 Bacteria 1730
31 Ga0075364_10054808 3300006051 Bacteria 2608
32 Ga0075364_10075742 3300006051 Bacteria 2220
33 Ga0075362_10000209 3300006177 Bacteria 16294
34 Ga0075362_10034881 3300006177 Bacteria 2195
35 Ga0075367_10004747 3300006178 Bacteria 6683
36 Ga0075369_10022421 3300006186 Bacteria 2604
37 Ga0075366_10076800 3300006195 Bacteria 1993
38 Ga0075366_10094275 3300006195 Bacteria 1794
39 Ga0075370_10041155 3300006353 Bacteria 2608
40 Ga0075370_10050753 3300006353 Bacteria 2353
41 Ga0079104_1007223 3300006946 Bacteria 4065
42 Ga0079104_1038404 3300006946 Bacteria 1135
43 Ga0105243_12999743 3300009148 Bacteria 512
44 Ga0105242_10291914 3300009176 Bacteria 1485
45 Ga0105238_11330057 3300009551 Bacteria 745
46 Ga0105148_100043 3300009978 Bacteria 18692
47 Ga0157373_11585568 3300013100 Bacteria 501
48 Ga0157371_10068956 3300013102 Bacteria 2503
49 Ga0157372_10035585 3300013307 Bacteria 5483
50 Ga0157372_11671476 3300013307 Bacteria 733
51 Ga0157372_11944417 3300013307 Bacteria 676
52 Ga0157375_11861488 3300013308 Bacteria 714
53 Ga0157380_10286813 3300014326 Bacteria 1509
54 Ga0157376_11438484 3300014969 Bacteria 721
55 Ga0209437_108331 3300025233 Bacteria 1661
56 Ga0209233_1000107 3300025261 Bacteria 267399
57 Ga0207656_10652905 3300025321 Bacteria 538
58 Ga0207682_10142667 3300025893 Bacteria 1076
59 Ga0207680_10293061 3300025903 Bacteria 1133
60 Ga0207646_10287450 3300025922 Bacteria 1486
61 Ga0207681_10085222 3300025923 Bacteria 2242
62 Ga0207681_10093434 3300025923 Bacteria 2153
63 Ga0207681_11415084 3300025923 Bacteria 583
64 Ga0207694_11203608 3300025924 Bacteria 641
65 Ga0207650_10012012 3300025925 Bacteria 5968
66 Ga0207679_10147362 3300025945 Bacteria 1911
67 Ga0207667_10045465 3300025949 Bacteria 4650
68 Ga0207668_10695238 3300025972 Bacteria 893
69 Ga0207668_11291718 3300025972 Bacteria 657
70 Ga0207640_10040148 3300025981 Bacteria 2966
71 Ga0207640_10047207 3300025981 Bacteria 2776
72 Ga0207640_10793773 3300025981 Bacteria 820
73 Ga0207658_10009083 3300025986 Bacteria 6742
74 Ga0207703_10020727 3300026035 Bacteria 5144
75 Ga0207674_10027100 3300026116 Bacteria 6070
76 Ga0207698_10518673 3300026142 Bacteria 1163
77 Ga0209281_1029392 3300027111 Bacteria 992
78 Ga0209281_1033256 3300027111 Bacteria 907
79 Ga0209983_1025455 3300027665 Bacteria 1248
80 Ga0209813_10000273 3300027866 Bacteria 14543
81 Ga0268266_10011988 3300028379 Bacteria 7505
82 Ga0268265_10031011 3300028380 Bacteria 3857
83 Ga0268264_10000067 3300028381 Bacteria 284445
84 Ga0268264_10580397 3300028381 Bacteria 1103
85 Ga0307408_100018797 3300031548 Bacteria 4644
86 Ga0307408_100332145 3300031548 Bacteria 1284
87 Ga0307408_100714065 3300031548 Bacteria 902
88 Ga0307408_102515327 3300031548 Bacteria 501
89 Ga0307405_10048151 3300031731 Bacteria 2628
90 Ga0307405_10410712 3300031731 Bacteria 1062
91 Ga0307405_10708087 3300031731 Bacteria 834
92 Ga0307405_11239737 3300031731 Bacteria 646
93 Ga0307413_10018487 3300031824 Bacteria 3659
94 Ga0307413_10036936 3300031824 Bacteria 2817
95 Ga0307413_10084809 3300031824 Bacteria 2043
96 Ga0307413_10183525 3300031824 Bacteria 1494
97 Ga0307413_10190832 3300031824 Bacteria 1471
98 Ga0307413_11062684 3300031824 Bacteria 697
99 Ga0307413_11105969 3300031824 Bacteria 685
100 Ga0307410_10064919 3300031852 Bacteria 2510
101 Ga0307410_10799442 3300031852 Bacteria 802
102 Ga0307410_11168378 3300031852 Bacteria 669
103 Ga0307410_11358197 3300031852 Bacteria 623
104 Ga0307410_11522284 3300031852 Bacteria 590
105 Ga0307410_11991636 3300031852 Bacteria 518
106 Ga0307406_10312534 3300031901 Bacteria 1212
107 Ga0307406_10584640 3300031901 Bacteria 918
108 Ga0307407_10173771 3300031903 Bacteria 1421
109 Ga0307407_10349202 3300031903 Bacteria 1047
110 Ga0307407_10481091 3300031903 Bacteria 907
111 Ga0307407_11616528 3300031903 Bacteria 514
112 Ga0307412_10083050 3300031911 Bacteria 2219
113 Ga0307412_10170807 3300031911 Bacteria 1625
114 Ga0307412_10199056 3300031911 Bacteria 1520
115 Ga0307412_10252956 3300031911 Bacteria 1369
116 Ga0307412_10395906 3300031911 Bacteria 1123
117 Ga0307412_10530293 3300031911 Bacteria 985
118 Ga0307412_10601266 3300031911 Bacteria 931
119 Ga0307412_10915292 3300031911 Bacteria 769
120 Ga0307409_100307161 3300031995 Bacteria 1478
121 Ga0307409_100409678 3300031995 Bacteria 1297
122 Ga0307409_100477196 3300031995 Bacteria 1209
123 Ga0307409_101093158 3300031995 Bacteria 818
124 Ga0307416_100305333 3300032002 Bacteria 1584
125 Ga0307416_100716921 3300032002 Bacteria 1090
126 Ga0307416_100928200 3300032002 Bacteria 971
127 Ga0307416_101533182 3300032002 Bacteria 772
128 Ga0307416_101544692 3300032002 Bacteria 769
129 Ga0307414_10000790 3300032004 Bacteria 16166
130 Ga0307414_10135809 3300032004 Bacteria 1917
131 Ga0307414_10404480 3300032004 Bacteria 1186
132 Ga0307414_10442612 3300032004 Bacteria 1138
133 Ga0307414_10618939 3300032004 Bacteria 973
134 Ga0307411_10041902 3300032005 Bacteria 2917
135 Ga0307411_10174303 3300032005 Bacteria 1625
136 Ga0307411_10247641 3300032005 Bacteria 1399
137 Ga0307411_10386702 3300032005 Bacteria 1152
138 Ga0307411_10467274 3300032005 Bacteria 1059
139 Ga0307411_10703622 3300032005 Bacteria 880
140 Ga0307411_11760208 3300032005 Bacteria 574
141 Ga0307411_12198825 3300032005 Bacteria 517
142 Ga0307411_12276962 3300032005 Bacteria 509
143 Ga0307415_100181307 3300032126 Bacteria 1652
144 Ga0307415_100536524 3300032126 Bacteria 1030
145 Ga0307415_102383445 3300032126 Bacteria 520
146 Ga0307415_102558147 3300032126 Bacteria 503
147 Ga0436363_0440562 3300039450 Bacteria 855
148 Ga0439465_0220360 3300041413 Bacteria 695
149 Ga0451793_0168784 3300041452 Bacteria 543
150 Ga0451793_0195783 3300041452 Bacteria 579
151 Ga0451797_1158827 3300041453 Bacteria 716
152 Ga0451804_0773089 3300041463 Bacteria 543
153 Ga0451804_0803855 3300041463 Bacteria 840
154 Ga0439446_0005737 3300042156 Bacteria 3206
155 Ga0495638_0000048 3300046460 Bacteria 209787
156 Ga0495650_0148963 3300046471 Bacteria 842
157 Ga0495583_0253787 3300046506 Bacteria 705
158 Ga0495663_0041528 3300046525 Bacteria 1399
159 Ga0495652_0814857 3300046529 Bacteria 621
160 Ga0495597_0090121 3300046542 Bacteria 1303
161 Ga0495625_0001633 3300046660 Bacteria 26389
162 Ga0495625_0207563 3300046660 Bacteria 1289
163 Ga0495686_0010154 3300047472 Bacteria 6718
164 Ga0495686_0104193 3300047472 Bacteria 1708
165 Ga0496115_0423888 3300048918 Bacteria 1078
166 Ga0496115_1462713 3300048918 Bacteria 502
167 Ga0496121_0068928 3300048924 Bacteria 2858
168 Ga0496122_0085014 3300048925 Bacteria 2185
169 Ga0496124_0327429 3300048927 Bacteria 1094
170 Ga0496124_0582669 3300048927 Bacteria 731
171 Ga0496126_0022190 3300048929 Bacteria 6182
172 Ga0496126_0133518 3300048929 Bacteria 2143
173 Ga0501033_0671778 3300049570 Bacteria 706
174 Ga0501034_0132536 3300049571 Bacteria 2475
175 Ga0501040_1210703 3300049576 Bacteria 548
176 Ga0501042_0460034 3300049578 Bacteria 923
177 Ga0501047_0565749 3300049581 Bacteria 960
178 Ga0501202_176821 3300049652 Bacteria 574
179 Ga0501223_000010 3300049663 Bacteria 106901
180 Ga0501235_007118 3300049669 Bacteria 2438
181 Ga0501235_209108 3300049669 Bacteria 531
182 Ga0501247_020524 3300049677 Bacteria 856
183 Ga0501225_0000008 3300049705 Bacteria 95521
184 Ga0501225_0004036 3300049705 Bacteria 4392
185 Ga0501241_178464 3300049758 Bacteria 503
186 Ga0501044_0114069 3300049823 Bacteria 2708
187 nmdc:mga03683_10661_c1 3300050489 Bacteria 3302
188 nmdc:mga03683_302_c1 3300050489 Bacteria 14592
189 nmdc:mga03n38_32255_c1 3300050490 Bacteria 2218
190 nmdc:mga03n38_43068_c1 3300050490 Bacteria 1977
191 nmdc:mga00v17_21471_c1 3300050491 Bacteria 3712
192 nmdc:mga00v17_21472_c1 3300050491 Bacteria 3712
193 nmdc:mga0yw44_10116_c2 3300050492 Bacteria 3302
194 nmdc:mga0yw44_9357_c1 3300050492 Bacteria 4948
195 nmdc:mga0k408_39900_c2 3300050493 Bacteria 2077
196 nmdc:mga0k408_44558_c1 3300050493 Bacteria 2559
197 nmdc:mga06z11_415_c1 3300050494 Bacteria 15958
198 nmdc:mga04h51_236_c1 3300050495 Bacteria 14571
199 nmdc:mga07m45_177381_c1 3300050496 Bacteria 1239
200 nmdc:mga07m45_17_c1 3300050496 Bacteria 140936
201 nmdc:mga07m45_81930_c1 3300050496 Bacteria 1843
202 nmdc:mga0sz30_17767_c1 3300050516 Bacteria 2840
203 nmdc:mga0sz30_26568_c1 3300050516 Bacteria 2374
204 Ga0500566_0000258 3300053094 Bacteria 28578
205 Ga0500562_009570 3300053108 Bacteria 2448
206 Ga0500594_0318410 3300053118 Bacteria 522
207 Ga0500608_000177 3300053122 Bacteria 26208
208 Ga0500658_0007352 3300053134 Bacteria 4066
209 Ga0500559_0082719 3300053136 Bacteria 1461
210 Ga0500559_0407053 3300053136 Bacteria 632
211 Ga0500616_0305487 3300053153 Bacteria 659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005578 Ga0068854_100863370 Ga0068854_1008633702 65
2 3300025981 Ga0207640_10793773 Ga0207640_107937732 65
3 3300005367 Ga0070667_100001283 Ga0070667_10000128317 68
4 3300005548 Ga0070665_100026073 Ga0070665_1000260735 68
5 3300005842 Ga0068858_100035259 Ga0068858_1000352595 68
6 3300005843 Ga0068860_100000093 Ga0068860_100000093154 68
7 3300005844 Ga0068862_100059676 Ga0068862_1000596763 68
8 3300013307 Ga0157372_11671476 Ga0157372_116714762 68
9 3300025903 Ga0207680_10293061 Ga0207680_102930611 68
10 3300025923 Ga0207681_11415084 Ga0207681_114150841 68
11 3300025986 Ga0207658_10009083 Ga0207658_100090838 68
12 3300026035 Ga0207703_10020727 Ga0207703_100207276 68
13 3300028379 Ga0268266_10011988 Ga0268266_100119885 68
14 3300028380 Ga0268265_10031011 Ga0268265_100310113 68
15 3300028381 Ga0268264_10000067 Ga0268264_10000067138 68
16 3300006038 Ga0075365_10222362 Ga0075365_102223622 69
17 3300006042 Ga0075368_10000289 Ga0075368_1000028915 69
18 3300006048 Ga0075363_100030218 Ga0075363_1000302183 69
19 3300006051 Ga0075364_10054808 Ga0075364_100548083 69
20 3300006177 Ga0075362_10000209 Ga0075362_1000020915 69
21 3300006178 Ga0075367_10004747 Ga0075367_100047475 69
22 3300006186 Ga0075369_10022421 Ga0075369_100224213 69
23 3300006195 Ga0075366_10094275 Ga0075366_100942752 69
24 3300006353 Ga0075370_10041155 Ga0075370_100411553 69
25 3300027866 Ga0209813_10000273 Ga0209813_100002732 69
26 3300050489 nmdc:mga03683_302_c1 nmdc:mga03683_302_c1_13756_13965 69
27 3300050490 nmdc:mga03n38_32255_c1 nmdc:mga03n38_32255_c1_1174_1383 69
28 3300050490 nmdc:mga03n38_43068_c1 nmdc:mga03n38_43068_c1_934_1143 69
29 3300050491 nmdc:mga00v17_21471_c1 nmdc:mga00v17_21471_c1_2894_3103 69
30 3300050491 nmdc:mga00v17_21472_c1 nmdc:mga00v17_21472_c1_2894_3103 69
31 3300050492 nmdc:mga0yw44_10116_c2 nmdc:mga0yw44_10116_c2_2515_2724 69
32 3300050492 nmdc:mga0yw44_9357_c1 nmdc:mga0yw44_9357_c1_648_857 69
33 3300050493 nmdc:mga0k408_44558_c1 nmdc:mga0k408_44558_c1_475_684 69
34 3300050494 nmdc:mga06z11_415_c1 nmdc:mga06z11_415_c1_1993_2202 69
35 3300050495 nmdc:mga04h51_236_c1 nmdc:mga04h51_236_c1_608_817 69
36 3300050496 nmdc:mga07m45_177381_c1 nmdc:mga07m45_177381_c1_424_633 69
37 3300050496 nmdc:mga07m45_17_c1 nmdc:mga07m45_17_c1_140100_140309 69
38 3300050516 nmdc:mga0sz30_17767_c1 nmdc:mga0sz30_17767_c1_2022_2231 69
39 3300050516 nmdc:mga0sz30_26568_c1 nmdc:mga0sz30_26568_c1_1538_1747 69
40 3300053136 Ga0500559_0407053 Ga0500559_0407053_206_451 69
41 iso_pu_bacteria 2512564014 2512645156 70
42 iso_pu_bacteria 2599185359 2600228055 70
43 iso_pu_bacteria 2775507255 2778125030 70
44 iso_pu_bacteria 2808606401 2809062487 70
45 iso_pu_bacteria 2808606404 2809078173 70
46 iso_pu_bacteria 2808606405 2809082876 70
47 iso_pu_bacteria 2880518877 2880522252 70
48 iso_pu_bacteria 2885429604 2885432637 70
49 iso_pu_bacteria 2895880812 2895884774 70
50 iso_pu_bacteria 2919709256 2919711388 70
51 3300025893 Ga0207682_10142667 Ga0207682_101426672 71
52 3300049578 Ga0501042_0460034 Ga0501042_0460034_218_433 71
53 3300006038 Ga0075365_10089525 Ga0075365_100895253 72
54 3300006048 Ga0075363_100085483 Ga0075363_1000854831 72
55 3300006051 Ga0075364_10075742 Ga0075364_100757423 72
56 3300006177 Ga0075362_10034881 Ga0075362_100348812 72
57 3300006195 Ga0075366_10076800 Ga0075366_100768004 72
58 3300006353 Ga0075370_10050753 Ga0075370_100507534 72
59 3300050489 nmdc:mga03683_10661_c1 nmdc:mga03683_10661_c1_1768_1986 72
60 3300050493 nmdc:mga0k408_39900_c2 nmdc:mga0k408_39900_c2_1543_1761 72
61 3300050496 nmdc:mga07m45_81930_c1 nmdc:mga07m45_81930_c1_910_1128 72
62 2162886007 SwRhRL2b_contig_1267906 SwRhRL2b_0917.00006140 74
63 3300005289 Ga0065704_10073598 Ga0065704_100735982 74
64 3300005295 Ga0065707_10485670 Ga0065707_104856703 74
65 3300005330 Ga0070690_101544441 Ga0070690_1015444412 74
66 3300005331 Ga0070670_100261775 Ga0070670_1002617752 74
67 3300005339 Ga0070660_101443370 Ga0070660_1014433702 74
68 3300005353 Ga0070669_100136542 Ga0070669_1001365423 74
69 3300005366 Ga0070659_100979015 Ga0070659_1009790152 74
70 3300005367 Ga0070667_101492410 Ga0070667_1014924102 74
71 3300005440 Ga0070705_100324594 Ga0070705_1003245942 74
72 3300005468 Ga0070707_100663554 Ga0070707_1006635542 74
73 3300005530 Ga0070679_101115225 Ga0070679_1011152252 74
74 3300005543 Ga0070672_101807150 Ga0070672_1018071502 74
75 3300005563 Ga0068855_100095138 Ga0068855_1000951385 74
76 3300005564 Ga0070664_100222085 Ga0070664_1002220852 74
77 3300005577 Ga0068857_100014577 Ga0068857_1000145772 74
78 3300005618 Ga0068864_100571408 Ga0068864_1005714083 74
79 3300005841 Ga0068863_100581243 Ga0068863_1005812433 74
80 3300005843 Ga0068860_100538214 Ga0068860_1005382142 74
81 3300006946 Ga0079104_1007223 Ga0079104_10072232 74
82 3300006946 Ga0079104_1038404 Ga0079104_10384042 74
83 3300009148 Ga0105243_12999743 Ga0105243_129997432 74
84 3300009176 Ga0105242_10291914 Ga0105242_102919142 74
85 3300009551 Ga0105238_11330057 Ga0105238_113300572 74
86 3300009978 Ga0105148_100043 Ga0105148_10004321 74
87 3300013100 Ga0157373_11585568 Ga0157373_115855681 74
88 3300013102 Ga0157371_10068956 Ga0157371_100689563 74
89 3300013307 Ga0157372_10035585 Ga0157372_100355857 74
90 3300013307 Ga0157372_11944417 Ga0157372_119444172 74
91 3300013308 Ga0157375_11861488 Ga0157375_118614882 74
92 3300014326 Ga0157380_10286813 Ga0157380_102868132 74
93 3300014969 Ga0157376_11438484 Ga0157376_114384841 74
94 3300025233 Ga0209437_108331 Ga0209437_1083312 74
95 3300025261 Ga0209233_1000107 Ga0209233_100010781 74
96 3300025321 Ga0207656_10652905 Ga0207656_106529051 74
97 3300025922 Ga0207646_10287450 Ga0207646_102874503 74
98 3300025923 Ga0207681_10085222 Ga0207681_100852222 74
99 3300025923 Ga0207681_10093434 Ga0207681_100934342 74
100 3300025924 Ga0207694_11203608 Ga0207694_112036082 74
101 3300025925 Ga0207650_10012012 Ga0207650_100120123 74
102 3300025945 Ga0207679_10147362 Ga0207679_101473622 74
103 3300025949 Ga0207667_10045465 Ga0207667_100454654 74
104 3300025972 Ga0207668_10695238 Ga0207668_106952382 74
105 3300025972 Ga0207668_11291718 Ga0207668_112917182 74
106 3300025981 Ga0207640_10040148 Ga0207640_100401484 74
107 3300025981 Ga0207640_10047207 Ga0207640_100472073 74
108 3300026116 Ga0207674_10027100 Ga0207674_100271007 74
109 3300026142 Ga0207698_10518673 Ga0207698_105186732 74
110 3300027111 Ga0209281_1029392 Ga0209281_10293922 74
111 3300027111 Ga0209281_1033256 Ga0209281_10332562 74
112 3300027665 Ga0209983_1025455 Ga0209983_10254552 74
113 3300028381 Ga0268264_10580397 Ga0268264_105803972 74
114 3300031548 Ga0307408_100018797 Ga0307408_1000187974 74
115 3300031548 Ga0307408_100332145 Ga0307408_1003321452 74
116 3300031548 Ga0307408_100714065 Ga0307408_1007140652 74
117 3300031548 Ga0307408_102515327 Ga0307408_1025153272 74
118 3300031731 Ga0307405_10048151 Ga0307405_100481512 74
119 3300031731 Ga0307405_10410712 Ga0307405_104107122 74
120 3300031731 Ga0307405_10708087 Ga0307405_107080872 74
121 3300031731 Ga0307405_11239737 Ga0307405_112397372 74
122 3300031824 Ga0307413_10018487 Ga0307413_100184872 74
123 3300031824 Ga0307413_10036936 Ga0307413_100369363 74
124 3300031824 Ga0307413_10084809 Ga0307413_100848092 74
125 3300031824 Ga0307413_10183525 Ga0307413_101835252 74
126 3300031824 Ga0307413_10190832 Ga0307413_101908322 74
127 3300031824 Ga0307413_11062684 Ga0307413_110626842 74
128 3300031824 Ga0307413_11105969 Ga0307413_111059692 74
129 3300031852 Ga0307410_10064919 Ga0307410_100649193 74
130 3300031852 Ga0307410_10799442 Ga0307410_107994422 74
131 3300031852 Ga0307410_11168378 Ga0307410_111683781 74
132 3300031852 Ga0307410_11358197 Ga0307410_113581972 74
133 3300031852 Ga0307410_11522284 Ga0307410_115222842 74
134 3300031852 Ga0307410_11991636 Ga0307410_119916361 74
135 3300031901 Ga0307406_10312534 Ga0307406_103125342 74
136 3300031901 Ga0307406_10584640 Ga0307406_105846402 74
137 3300031903 Ga0307407_10173771 Ga0307407_101737713 74
138 3300031903 Ga0307407_10349202 Ga0307407_103492022 74
139 3300031903 Ga0307407_10481091 Ga0307407_104810912 74
140 3300031903 Ga0307407_11616528 Ga0307407_116165282 74
141 3300031911 Ga0307412_10083050 Ga0307412_100830503 74
142 3300031911 Ga0307412_10170807 Ga0307412_101708072 74
143 3300031911 Ga0307412_10199056 Ga0307412_101990563 74
144 3300031911 Ga0307412_10252956 Ga0307412_102529562 74
145 3300031911 Ga0307412_10395906 Ga0307412_103959062 74
146 3300031911 Ga0307412_10530293 Ga0307412_105302932 74
147 3300031911 Ga0307412_10601266 Ga0307412_106012662 74
148 3300031911 Ga0307412_10915292 Ga0307412_109152921 74
149 3300031995 Ga0307409_100307161 Ga0307409_1003071611 74
150 3300031995 Ga0307409_100409678 Ga0307409_1004096782 74
151 3300031995 Ga0307409_100477196 Ga0307409_1004771962 74
152 3300031995 Ga0307409_101093158 Ga0307409_1010931582 74
153 3300032002 Ga0307416_100305333 Ga0307416_1003053333 74
154 3300032002 Ga0307416_100716921 Ga0307416_1007169212 74
155 3300032002 Ga0307416_100928200 Ga0307416_1009282002 74
156 3300032002 Ga0307416_101533182 Ga0307416_1015331822 74
157 3300032002 Ga0307416_101544692 Ga0307416_1015446921 74
158 3300032004 Ga0307414_10000790 Ga0307414_1000079015 74
159 3300032004 Ga0307414_10135809 Ga0307414_101358092 74
160 3300032004 Ga0307414_10404480 Ga0307414_104044802 74
161 3300032004 Ga0307414_10442612 Ga0307414_104426122 74
162 3300032004 Ga0307414_10618939 Ga0307414_106189392 74
163 3300032005 Ga0307411_10041902 Ga0307411_100419022 74
164 3300032005 Ga0307411_10174303 Ga0307411_101743032 74
165 3300032005 Ga0307411_10247641 Ga0307411_102476412 74
166 3300032005 Ga0307411_10386702 Ga0307411_103867022 74
167 3300032005 Ga0307411_10467274 Ga0307411_104672742 74
168 3300032005 Ga0307411_10703622 Ga0307411_107036222 74
169 3300032005 Ga0307411_11760208 Ga0307411_117602081 74
170 3300032005 Ga0307411_12198825 Ga0307411_121988252 74
171 3300032005 Ga0307411_12276962 Ga0307411_122769622 74
172 3300032126 Ga0307415_100181307 Ga0307415_1001813072 74
173 3300032126 Ga0307415_100536524 Ga0307415_1005365242 74
174 3300032126 Ga0307415_102383445 Ga0307415_1023834452 74
175 3300032126 Ga0307415_102558147 Ga0307415_1025581472 74
176 3300039450 Ga0436363_0440562 Ga0436363_0440562_322_546 74
177 3300041413 Ga0439465_0220360 Ga0439465_0220360_264_488 74
178 3300041452 Ga0451793_0168784 Ga0451793_0168784_213_437 74
179 3300041452 Ga0451793_0195783 Ga0451793_0195783_143_373 74
180 3300041453 Ga0451797_1158827 Ga0451797_1158827_133_360 74
181 3300041463 Ga0451804_0773089 Ga0451804_0773089_253_483 74
182 3300041463 Ga0451804_0803855 Ga0451804_0803855_417_644 74
183 3300042156 Ga0439446_0005737 Ga0439446_0005737_550_774 74
184 3300046460 Ga0495638_0000048 Ga0495638_0000048_97837_98067 74
185 3300046471 Ga0495650_0148963 Ga0495650_0148963_100_324 74
186 3300046506 Ga0495583_0253787 Ga0495583_0253787_86_310 74
187 3300046525 Ga0495663_0041528 Ga0495663_0041528_257_487 74
188 3300046529 Ga0495652_0814857 Ga0495652_0814857_334_558 74
189 3300046542 Ga0495597_0090121 Ga0495597_0090121_403_633 74
190 3300046660 Ga0495625_0001633 Ga0495625_0001633_19171_19401 74
191 3300046660 Ga0495625_0207563 Ga0495625_0207563_382_612 74
192 3300047472 Ga0495686_0010154 Ga0495686_0010154_5778_6008 74
193 3300047472 Ga0495686_0104193 Ga0495686_0104193_1415_1645 74
194 3300048918 Ga0496115_0423888 Ga0496115_0423888_605_829 74
195 3300048918 Ga0496115_1462713 Ga0496115_1462713_155_379 74
196 3300048924 Ga0496121_0068928 Ga0496121_0068928_2117_2347 74
197 3300048925 Ga0496122_0085014 Ga0496122_0085014_162_386 74
198 3300048927 Ga0496124_0327429 Ga0496124_0327429_674_898 74
199 3300048927 Ga0496124_0582669 Ga0496124_0582669_412_636 74
200 3300048929 Ga0496126_0022190 Ga0496126_0022190_3445_3669 74
201 3300048929 Ga0496126_0133518 Ga0496126_0133518_1085_1309 74
202 3300049570 Ga0501033_0671778 Ga0501033_0671778_108_332 74
203 3300049571 Ga0501034_0132536 Ga0501034_0132536_1698_1922 74
204 3300049576 Ga0501040_1210703 Ga0501040_1210703_275_499 74
205 3300049581 Ga0501047_0565749 Ga0501047_0565749_503_727 74
206 3300049652 Ga0501202_176821 Ga0501202_176821_209_433 74
207 3300049663 Ga0501223_000010 Ga0501223_000010_104360_104584 74
208 3300049669 Ga0501235_007118 Ga0501235_007118_281_505 74
209 3300049669 Ga0501235_209108 Ga0501235_209108_152_376 74
210 3300049677 Ga0501247_020524 Ga0501247_020524_622_846 74
211 3300049705 Ga0501225_0000008 Ga0501225_0000008_92712_92936 74
212 3300049705 Ga0501225_0004036 Ga0501225_0004036_11_235 74
213 3300049758 Ga0501241_178464 Ga0501241_178464_38_340 74
214 3300049823 Ga0501044_0114069 Ga0501044_0114069_721_945 74
215 3300053094 Ga0500566_0000258 Ga0500566_0000258_26806_27030 74
216 3300053108 Ga0500562_009570 Ga0500562_009570_1549_1779 74
217 3300053118 Ga0500594_0318410 Ga0500594_0318410_251_475 74
218 3300053122 Ga0500608_000177 Ga0500608_000177_10590_10814 74
219 3300053134 Ga0500658_0007352 Ga0500658_0007352_2380_2610 74
220 3300053136 Ga0500559_0082719 Ga0500559_0082719_1104_1328 74
221 3300053153 Ga0500616_0305487 Ga0500616_0305487_45_275 74

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06906

DUF1272

Protein of unknown function (DUF1272)

10

65

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rmi-assembly1.cif.gz_A human sirt2 in complex with sirreal1 and ac-lys-otc peptide 0.6999 22 52
6l66-assembly1.cif.gz_A sirtuin 2 protein with h3k18 myristoylated peptide and intact nad molecule 0.6883 19 52
7dde-assembly1.cif.gz_A cryo-em structure of the ape4 and nbr1 complex 0.6881 7 53
6cw3-assembly1.cif.gz_G crystal structure of a yeast saga transcriptional coactivator ada2/gcn5 hat subcomplex, crystal form 2 0.6869 7 58
5yp8-assembly1.cif.gz_A p62/sqstm1 zz domain with arg-peptide 0.6833 5 56
ID Description Score Start End Superfamily
af_E7FB16_49_109_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.8659 7 38 2.10.110.10
af_Q8IR79_94_151_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.8534 6 38 2.10.110.10
af_P29590_49_104_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7303 4 49 3.30.40.10
af_Q9UT72_143_205_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7251 5 54 3.30.40.10
af_Q54FB2_9_111_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7061 6 53 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A4Q1KDR2-F1-model_v4 DUF1272 domain-containing protein 0.9663 1 74
AF-A0A6G6YBF2-F1-model_v4 DUF1272 domain-containing protein 0.9643 1 74
AF-A0A4R6FCH6-F1-model_v4 deleted 0.9638 1 74
AF-A0A4P7RXV4-F1-model_v4 DUF1272 domain-containing protein 0.9637 1 74
AF-A0A839YDW7-F1-model_v4 DUF1272 domain-containing protein 0.9614 1 74

Feature Viewer

pLDDT pTM Quality
75.05 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map