F333385

General Info

Members Datasets Scaffolds Average Seq Length
221 133 442 219

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10105098|Ga0163162_101050985
Length 206
Sequence MGQIFHRSANTISRVTIFGAIFFVGFILWVIGGIIRSPFFTNQGVQREQPIPFSHQHHVAGLGIDCRYCHTSVETSSFAGIPPTQTCMAEMLEPVRASFANNKPIVWSRVHRLPDFVHFYHSIHINKGIGCATCHGRIDKMALTFQAAPLTMEWCISCHRAPEKYVRPRNQVFNMAYVPVNQEEDGPRLVKEYKIQKLTACSTCHY

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
80 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
81 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
82 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
94 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
95 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
96 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
109 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
110 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
111 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
112 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
113 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
117 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
118 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
121 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
122 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 3.62
Rhizosphere 94.57
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10105098 3300013306 Bacteria 2918
2 Ga0065715_10156078 3300005293 Bacteria 1654
3 Ga0070689_100710603 3300005340 Bacteria 878
4 Ga0070675_100545913 3300005354 Bacteria 1048
5 Ga0070709_10075563 3300005434 Bacteria 2186
6 Ga0070714_100001627 3300005435 Bacteria 16344
7 Ga0070713_100006450 3300005436 Bacteria 8135
8 Ga0070705_100519131 3300005440 Unclassified 908
9 Ga0070700_100728819 3300005441 Unclassified 791
10 Ga0070678_100390139 3300005456 Bacteria 1207
11 Ga0070662_100759105 3300005457 Bacteria 823
12 Ga0070697_100065121 3300005536 Bacteria 2977
13 Ga0070697_100151990 3300005536 Bacteria 1951
14 Ga0070672_100538307 3300005543 Bacteria 1013
15 Ga0070695_100454391 3300005545 Unclassified 982
16 Ga0070696_100019478 3300005546 Bacteria 4594
17 Ga0070665_100089046 3300005548 Bacteria 3092
18 Ga0068854_100684101 3300005578 Bacteria 884
19 Ga0068859_100074839 3300005617 Bacteria 3426
20 Ga0068861_100028604 3300005719 Bacteria 4068
21 Ga0068870_10113761 3300005840 Bacteria 1549
22 Ga0068863_100597554 3300005841 Bacteria 1092
23 Ga0070717_10003730 3300006028 Bacteria 10944
24 Ga0070717_10060320 3300006028 Bacteria 3141
25 Ga0070717_10073599 3300006028 Bacteria 2856
26 Ga0075368_10023303 3300006042 Bacteria 2363
27 Ga0068871_101178935 3300006358 Bacteria 718
28 Ga0075428_100006305 3300006844 Bacteria 13185
29 Ga0075428_100164244 3300006844 Bacteria 2409
30 Ga0075430_100001266 3300006846 Bacteria 20350
31 Ga0075430_100003080 3300006846 Bacteria 13926
32 Ga0075430_100046880 3300006846 Bacteria 3650
33 Ga0075430_100058596 3300006846 Bacteria 3237
34 Ga0075430_100134964 3300006846 Bacteria 2056
35 Ga0075430_100155883 3300006846 Bacteria 1901
36 Ga0075431_100022858 3300006847 Bacteria 6392
37 Ga0075431_100088107 3300006847 Unclassified 3203
38 Ga0075431_100106457 3300006847 Bacteria 2893
39 Ga0075431_100117308 3300006847 Bacteria 2747
40 Ga0075431_100127234 3300006847 Bacteria 2629
41 Ga0075433_10052792 3300006852 Bacteria 3542
42 Ga0075433_10150374 3300006852 Bacteria 2071
43 Ga0075429_100001273 3300006880 Bacteria 20512
44 Ga0075429_100051086 3300006880 Bacteria 3598
45 Ga0075429_100111096 3300006880 Bacteria 2396
46 Ga0075429_100614412 3300006880 Bacteria 952
47 Ga0075429_100623506 3300006880 Unclassified 945
48 Ga0097620_100074838 3300006931 Bacteria 3426
49 Ga0111539_10002190 3300009094 Bacteria 26090
50 Ga0111539_10901117 3300009094 Bacteria 1029
51 Ga0111539_11034602 3300009094 Bacteria 955
52 Ga0111539_11049721 3300009094 Bacteria 947
53 Ga0105245_10000242 3300009098 Bacteria 52045
54 Ga0114129_10000204 3300009147 Bacteria 65893
55 Ga0114129_10006116 3300009147 Bacteria 17071
56 Ga0114129_10015565 3300009147 Bacteria 10813
57 Ga0114129_10017847 3300009147 Bacteria 10105
58 Ga0114129_10047697 3300009147 Bacteria 6019
59 Ga0114129_10064890 3300009147 Bacteria 5096
60 Ga0114129_10065970 3300009147 Bacteria 5049
61 Ga0114129_10095722 3300009147 Bacteria 4112
62 Ga0114129_10806497 3300009147 Bacteria 1197
63 Ga0105242_10499499 3300009176 Bacteria 1157
64 Ga0105242_10749097 3300009176 Bacteria 961
65 Ga0105249_10886203 3300009553 Unclassified 959
66 Ga0105239_10444925 3300010375 Bacteria 1469
67 Ga0157369_10160945 3300013105 Bacteria 2369
68 Ga0157378_10192068 3300013297 Unclassified 1926
69 Ga0157380_10012315 3300014326 Bacteria 6202
70 Ga0157380_10382020 3300014326 Bacteria 1329
71 Ga0157380_10423320 3300014326 Bacteria 1271
72 Ga0163161_10694665 3300017792 Bacteria 847
73 Ga0207697_10046065 3300025315 Bacteria 1795
74 Ga0207699_10121879 3300025906 Bacteria 1688
75 Ga0207699_10217910 3300025906 Unclassified 1301
76 Ga0207663_10106645 3300025916 Bacteria 1894
77 Ga0207659_10475270 3300025926 Bacteria 1055
78 Ga0207700_10022524 3300025928 Bacteria 4326
79 Ga0207664_10027564 3300025929 Bacteria 4308
80 Ga0207704_10340128 3300025938 Bacteria 1165
81 Ga0207691_10344247 3300025940 Bacteria 1276
82 Ga0207678_10048655 3300026067 Bacteria 3664
83 Ga0207675_100017940 3300026118 Bacteria 6600
84 Ga0207683_10391545 3300026121 Bacteria 1278
85 Ga0209813_10003939 3300027866 Bacteria 3514
86 Ga0207428_10000518 3300027907 Bacteria 46060
87 Ga0268265_10627737 3300028380 Eukaryota 1030
88 Ga0265330_10005991 3300031235 Bacteria 6018
89 Ga0265332_10001558 3300031238 Bacteria 12604
90 Ga0265328_10000333 3300031239 Bacteria 22080
91 Ga0265329_10002120 3300031242 Bacteria 9188
92 Ga0265329_10008004 3300031242 Bacteria 4044
93 Ga0265339_10128186 3300031249 Bacteria 1299
94 Ga0265331_10000074 3300031250 Bacteria 149282
95 Ga0265316_10000037 3300031344 Bacteria 149295
96 Ga0307408_100031198 3300031548 Bacteria 3710
97 Ga0307408_100079583 3300031548 Bacteria 2446
98 Ga0265314_10001565 3300031711 Bacteria 25163
99 Ga0265342_10002766 3300031712 Bacteria 14871
100 Ga0307405_10570902 3300031731 Bacteria 918
101 Ga0307413_10060427 3300031824 Bacteria 2333
102 Ga0307413_10095436 3300031824 Bacteria 1950
103 Ga0307410_10103501 3300031852 Bacteria 2045
104 Ga0307406_10115338 3300031901 Bacteria 1857
105 Ga0307406_10145278 3300031901 Bacteria 1685
106 Ga0307406_10472890 3300031901 Bacteria 1010
107 Ga0307407_10064256 3300031903 Bacteria 2156
108 Ga0307407_10252332 3300031903 Bacteria 1209
109 Ga0307412_10149825 3300031911 Bacteria 1720
110 Ga0307412_10367097 3300031911 Bacteria 1161
111 Ga0307409_100017922 3300031995 Bacteria 4738
112 Ga0307409_100459703 3300031995 Bacteria 1230
113 Ga0307416_100002993 3300032002 Bacteria 9858
114 Ga0307416_100128729 3300032002 Bacteria 2273
115 Ga0307416_100183410 3300032002 Bacteria 1964
116 Ga0307414_10604656 3300032004 Bacteria 984
117 Ga0307411_10040374 3300032005 Bacteria 2960
118 Ga0307411_10072951 3300032005 Bacteria 2333
119 Ga0307411_10297055 3300032005 Bacteria 1293
120 Ga0307415_100019796 3300032126 Bacteria 4094
121 Ga0307415_100098570 3300032126 Bacteria 2137
122 Ga0307415_100303708 3300032126 Bacteria 1323
123 Ga0373935_0013394 3300035692 Bacteria 4948
124 Ga0373937_0007081 3300036401 Bacteria 9687
125 Ga0373925_0710278 3300037068 Bacteria 829
126 Ga0439453_0077308 3300041408 Bacteria 713
127 Ga0439450_007233 3300042008 Bacteria 2028
128 Ga0439446_0074451 3300042156 Bacteria 1043
129 Ga0439464_0014201 3300042439 Bacteria 2139
130 Ga0451577_0033613 3300042876 Bacteria 4623
131 Ga0495580_0454048 3300046472 Bacteria 860
132 Ga0495647_0334744 3300046681 Bacteria 687
133 Ga0496100_0411428 3300048903 Bacteria 1032
134 Ga0496101_0354425 3300048904 Bacteria 1153
135 Ga0496102_0022623 3300048905 Bacteria 5570
136 Ga0496104_0636284 3300048907 Bacteria 976
137 Ga0496106_0007297 3300048909 Bacteria 8167
138 Ga0496106_0381786 3300048909 Bacteria 1132
139 Ga0496108_0070766 3300048911 Bacteria 2944
140 Ga0496111_0365839 3300048914 Bacteria 1067
141 Ga0501290_009840 3300049513 Bacteria 1218
142 Ga0501292_023971 3300049515 Bacteria 999
143 Ga0501299_008197 3300049522 Bacteria 1693
144 Ga0501300_026300 3300049523 Bacteria 854
145 Ga0501036_0166550 3300049572 Bacteria 1857
146 Ga0501036_0372881 3300049572 Bacteria 1191
147 Ga0501036_0542329 3300049572 Bacteria 967
148 Ga0501040_0013516 3300049576 Bacteria 5367
149 Ga0501040_0068208 3300049576 Bacteria 2453
150 Ga0501041_0133938 3300049577 Bacteria 1544
151 Ga0501041_0144596 3300049577 Bacteria 1483
152 Ga0501042_0021000 3300049578 Bacteria 4547
153 Ga0501042_0227562 3300049578 Bacteria 1345
154 Ga0501046_0055214 3300049580 Bacteria 3123
155 Ga0501048_0038349 3300049582 Bacteria 3438
156 Ga0501070_0324939 3300049586 Bacteria 1251
157 Ga0501071_0080224 3300049587 Bacteria 2386
158 Ga0501071_0104212 3300049587 Bacteria 2093
159 Ga0501075_0020388 3300049591 Bacteria 4822
160 Ga0501075_0502675 3300049591 Bacteria 925
161 Ga0501076_0020574 3300049592 Bacteria 5052
162 Ga0501076_0028210 3300049592 Bacteria 4357
163 Ga0501076_0135575 3300049592 Bacteria 1998
164 Ga0501076_0332735 3300049592 Bacteria 1246
165 Ga0501076_0758691 3300049592 Bacteria 801
166 Ga0501077_0003441 3300049593 Bacteria 9513
167 Ga0501077_0177599 3300049593 Bacteria 1353
168 Ga0501209_048701 3300049656 Bacteria 1149
169 Ga0501216_017647 3300049660 Bacteria 1222
170 Ga0501217_051895 3300049661 Bacteria 1074
171 Ga0501223_053151 3300049663 Bacteria 787
172 Ga0501235_016891 3300049669 Bacteria 1614
173 Ga0501079_0045396 3300049741 Bacteria 3391
174 Ga0501079_0089553 3300049741 Bacteria 2383
175 Ga0501079_0187382 3300049741 Bacteria 1615
176 Ga0501079_0283659 3300049741 Bacteria 1295
177 Ga0501080_0046732 3300049742 Bacteria 4030
178 Ga0501080_0186571 3300049742 Bacteria 1907
179 Ga0501080_0246206 3300049742 Bacteria 1631
180 Ga0501081_0067102 3300049743 Bacteria 2496
181 Ga0501081_0068265 3300049743 Bacteria 2475
182 Ga0501273_019515 3300049770 Bacteria 909
183 Ga0501279_007041 3300049775 Bacteria 1491
184 Ga0501283_009580 3300049779 Bacteria 1414
185 Ga0501045_0552575 3300049824 Bacteria 854
186 Ga0501212_004727 3300049851 Bacteria 1775
187 nmdc:mga06z11_138611_c1 3300050494 Bacteria 1373
188 nmdc:mga04h51_9338_c1 3300050495 Bacteria 2655
189 nmdc:mga05p37_16171_c1 3300050507 Bacteria 8983
190 nmdc:mga05p37_209550_c1 3300050507 Bacteria 2357
191 nmdc:mga05p37_230617_c1 3300050507 Bacteria 2231
192 nmdc:mga05p37_23993_c1 3300050507 Bacteria 7408
193 nmdc:mga05p37_327728_c1 3300050507 Bacteria 1810
194 nmdc:mga05p37_3418_c1 3300050507 Bacteria 18527
195 nmdc:mga05p37_81650_c1 3300050507 Bacteria 3982
196 nmdc:mga09592_136135_c1 3300050508 Bacteria 2116
197 nmdc:mga09592_144475_c1 3300050508 Bacteria 2051
198 nmdc:mga09592_497895_c1 3300050508 Unclassified 1049
199 nmdc:mga09592_542520_c1 3300050508 Bacteria 999
200 nmdc:mga09592_5875_c1 3300050508 Bacteria 10017
201 nmdc:mga09592_66398_c1 3300050508 Bacteria 3057
202 nmdc:mga0qj67_118879_c1 3300050509 Bacteria 2137
203 nmdc:mga0qj67_118967_c1 3300050509 Bacteria 2136
204 nmdc:mga0qj67_134937_c1 3300050509 Bacteria 2000
205 nmdc:mga0qj67_2012_c1 3300050509 Bacteria 14499
206 nmdc:mga0qj67_74531_c1 3300050509 Bacteria 2712
207 nmdc:mga06r32_153765_c1 3300050510 Unclassified 2280
208 nmdc:mga06r32_26331_c1 3300050510 Bacteria 5421
209 nmdc:mga06r32_63658_c1 3300050510 Bacteria 3556
210 nmdc:mga08y16_17001_c1 3300050511 Bacteria 7660
211 nmdc:mga08y16_731627_c1 3300050511 Bacteria 987
212 nmdc:mga08y16_74454_c1 3300050511 Bacteria 3538
213 nmdc:mga08y16_756940_c1 3300050511 Bacteria 967
214 nmdc:mga08y16_765963_c1 3300050511 Bacteria 960
215 nmdc:mga0a205_57565_c1 3300050515 Bacteria 3753
216 nmdc:mga0a205_87509_c1 3300050515 Bacteria 3010
217 Ga0501084_0445022 3300054114 Bacteria 1095
218 Ga0590071_018164 3300059421 Bacteria 1654
219 Ga0590077_005742 3300059426 Bacteria 2541
220 Ga0501082_0648454 3300060353 Bacteria 924
221 Ga0530510_0007127 3300061734 Bacteria 7782
222 Ga0163162_10105098
223 Ga0065715_10156078
224 Ga0070689_100710603
225 Ga0070675_100545913
226 Ga0070709_10075563
227 Ga0070714_100001627
228 Ga0070713_100006450
229 Ga0070705_100519131
230 Ga0070700_100728819
231 Ga0070678_100390139
232 Ga0070662_100759105
233 Ga0070697_100065121
234 Ga0070697_100151990
235 Ga0070672_100538307
236 Ga0070695_100454391
237 Ga0070696_100019478
238 Ga0070665_100089046
239 Ga0068854_100684101
240 Ga0068859_100074839
241 Ga0068861_100028604
242 Ga0068870_10113761
243 Ga0068863_100597554
244 Ga0070717_10003730
245 Ga0070717_10060320
246 Ga0070717_10073599
247 Ga0075368_10023303
248 Ga0068871_101178935
249 Ga0075428_100006305
250 Ga0075428_100164244
251 Ga0075430_100001266
252 Ga0075430_100003080
253 Ga0075430_100046880
254 Ga0075430_100058596
255 Ga0075430_100134964
256 Ga0075430_100155883
257 Ga0075431_100022858
258 Ga0075431_100088107
259 Ga0075431_100106457
260 Ga0075431_100117308
261 Ga0075431_100127234
262 Ga0075433_10052792
263 Ga0075433_10150374
264 Ga0075429_100001273
265 Ga0075429_100051086
266 Ga0075429_100111096
267 Ga0075429_100614412
268 Ga0075429_100623506
269 Ga0097620_100074838
270 Ga0111539_10002190
271 Ga0111539_10901117
272 Ga0111539_11034602
273 Ga0111539_11049721
274 Ga0105245_10000242
275 Ga0114129_10000204
276 Ga0114129_10006116
277 Ga0114129_10015565
278 Ga0114129_10017847
279 Ga0114129_10047697
280 Ga0114129_10064890
281 Ga0114129_10065970
282 Ga0114129_10095722
283 Ga0114129_10806497
284 Ga0105242_10499499
285 Ga0105242_10749097
286 Ga0105249_10886203
287 Ga0105239_10444925
288 Ga0157369_10160945
289 Ga0157378_10192068
290 Ga0157380_10012315
291 Ga0157380_10382020
292 Ga0157380_10423320
293 Ga0163161_10694665
294 Ga0207697_10046065
295 Ga0207699_10121879
296 Ga0207699_10217910
297 Ga0207663_10106645
298 Ga0207659_10475270
299 Ga0207700_10022524
300 Ga0207664_10027564
301 Ga0207704_10340128
302 Ga0207691_10344247
303 Ga0207678_10048655
304 Ga0207675_100017940
305 Ga0207683_10391545
306 Ga0209813_10003939
307 Ga0207428_10000518
308 Ga0268265_10627737
309 Ga0265330_10005991
310 Ga0265332_10001558
311 Ga0265328_10000333
312 Ga0265329_10002120
313 Ga0265329_10008004
314 Ga0265339_10128186
315 Ga0265331_10000074
316 Ga0265316_10000037
317 Ga0307408_100031198
318 Ga0307408_100079583
319 Ga0265314_10001565
320 Ga0265342_10002766
321 Ga0307405_10570902
322 Ga0307413_10060427
323 Ga0307413_10095436
324 Ga0307410_10103501
325 Ga0307406_10115338
326 Ga0307406_10145278
327 Ga0307406_10472890
328 Ga0307407_10064256
329 Ga0307407_10252332
330 Ga0307412_10149825
331 Ga0307412_10367097
332 Ga0307409_100017922
333 Ga0307409_100459703
334 Ga0307416_100002993
335 Ga0307416_100128729
336 Ga0307416_100183410
337 Ga0307414_10604656
338 Ga0307411_10040374
339 Ga0307411_10072951
340 Ga0307411_10297055
341 Ga0307415_100019796
342 Ga0307415_100098570
343 Ga0307415_100303708
344 Ga0373935_0013394
345 Ga0373937_0007081
346 Ga0373925_0710278
347 Ga0439453_0077308
348 Ga0439450_007233
349 Ga0439446_0074451
350 Ga0439464_0014201
351 Ga0451577_0033613
352 Ga0495580_0454048
353 Ga0495647_0334744
354 Ga0496100_0411428
355 Ga0496101_0354425
356 Ga0496102_0022623
357 Ga0496104_0636284
358 Ga0496106_0007297
359 Ga0496106_0381786
360 Ga0496108_0070766
361 Ga0496111_0365839
362 Ga0501290_009840
363 Ga0501292_023971
364 Ga0501299_008197
365 Ga0501300_026300
366 Ga0501036_0166550
367 Ga0501036_0372881
368 Ga0501036_0542329
369 Ga0501040_0013516
370 Ga0501040_0068208
371 Ga0501041_0133938
372 Ga0501041_0144596
373 Ga0501042_0021000
374 Ga0501042_0227562
375 Ga0501046_0055214
376 Ga0501048_0038349
377 Ga0501070_0324939
378 Ga0501071_0080224
379 Ga0501071_0104212
380 Ga0501075_0020388
381 Ga0501075_0502675
382 Ga0501076_0020574
383 Ga0501076_0028210
384 Ga0501076_0135575
385 Ga0501076_0332735
386 Ga0501076_0758691
387 Ga0501077_0003441
388 Ga0501077_0177599
389 Ga0501209_048701
390 Ga0501216_017647
391 Ga0501217_051895
392 Ga0501223_053151
393 Ga0501235_016891
394 Ga0501079_0045396
395 Ga0501079_0089553
396 Ga0501079_0187382
397 Ga0501079_0283659
398 Ga0501080_0046732
399 Ga0501080_0186571
400 Ga0501080_0246206
401 Ga0501081_0067102
402 Ga0501081_0068265
403 Ga0501273_019515
404 Ga0501279_007041
405 Ga0501283_009580
406 Ga0501045_0552575
407 Ga0501212_004727
408 nmdc:mga06z11_138611_c1
409 nmdc:mga04h51_9338_c1
410 nmdc:mga05p37_16171_c1
411 nmdc:mga05p37_209550_c1
412 nmdc:mga05p37_230617_c1
413 nmdc:mga05p37_23993_c1
414 nmdc:mga05p37_327728_c1
415 nmdc:mga05p37_3418_c1
416 nmdc:mga05p37_81650_c1
417 nmdc:mga09592_136135_c1
418 nmdc:mga09592_144475_c1
419 nmdc:mga09592_497895_c1
420 nmdc:mga09592_542520_c1
421 nmdc:mga09592_5875_c1
422 nmdc:mga09592_66398_c1
423 nmdc:mga0qj67_118879_c1
424 nmdc:mga0qj67_118967_c1
425 nmdc:mga0qj67_134937_c1
426 nmdc:mga0qj67_2012_c1
427 nmdc:mga0qj67_74531_c1
428 nmdc:mga06r32_153765_c1
429 nmdc:mga06r32_26331_c1
430 nmdc:mga06r32_63658_c1
431 nmdc:mga08y16_17001_c1
432 nmdc:mga08y16_731627_c1
433 nmdc:mga08y16_74454_c1
434 nmdc:mga08y16_756940_c1
435 nmdc:mga08y16_765963_c1
436 nmdc:mga0a205_57565_c1
437 nmdc:mga0a205_87509_c1
438 Ga0501084_0445022
439 Ga0590071_018164
440 Ga0590077_005742
441 Ga0501082_0648454
442 Ga0530510_0007127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14522

Cytochrome_C7

Cytochrome c7 and related cytochrome c

117

206

0.83

PF14537

Cytochrom_c3_2

Cytochrome c3

123

206

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.6772 5 219
6loe-assembly1.cif.gz_A cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.6664 5 219
6f0k-assembly1.cif.gz_A alternative complex iii 0.6661 9 219
6f0k-assembly1.cif.gz_A alternative complex iii 0.6612 9 219
6btm-assembly1.cif.gz_A structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.5107 15 219
ID Description Score Start End Superfamily
af_E7FFE4_489_680_1.10.579.10 Mainly Alpha;Orthogonal Bundle;DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3;DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 0.2584 56 214 1.10.579.10
af_E7FFE4_489_680_1.10.579.10 Mainly Alpha;Orthogonal Bundle;DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3;DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 0.2204 56 214 1.10.579.10
af_Q4DF29_285_540_3.30.2350.20 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;TruD, catalytic domain 0.1895 71 212 3.30.2350.20
af_A0A0G2KPL0_88_362_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.1435 55 205 3.40.50.300
af_P43428_13_210_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.1395 84 216 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A3M0YSD5-F1-model_v4 deleted 0.9307 158 219
AF-A0A1I2GTL6-F1-model_v4 deleted 0.9211 135 219
AF-A0A3M0YSD5-F1-model_v4 deleted 0.9168 158 219
AF-A0A2V9T9S4-F1-model_v4 Cytochrome C 0.9102 120 219
AF-A0A1I2GTL6-F1-model_v4 deleted 0.9012 135 219

Map