F333226

General Info

Members Datasets Scaffolds Average Seq Length
221 160 442 351

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10057495|Ga0075365_100574952
Length 362
Sequence MSLTLTVDGDRWRSHLLATVAKHPGIVPVAKGNGYGLTVGRLARRAQWLAEHAEETGARLDLLAVGTYDEIDQAATRFDGDLLVLTPWRPFGAALDLDQRTSSRVVHTVSRPDDLAALRERDPGARFVLEQLTSMLRHGMTRRDLATAAEALRETGTGRGGLRGVAMHLPLNTTSHLSEVSRLINDIVASGLPTRTVFVSHLTHGELARLATSYPDFTVRPRIGTALWLGDRGALAVTATVLDVHDVERGEVFGYRGRSVPKAGHIVVVSGGTAHGIGLEAPTGDQSLKARAATLARGGLDAVGFVRSPFSIDGKQRLFAEPPHMQASMLFVPSGARVPRVGEEIEVRVRFTATDFDRVVVA

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
86 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
87 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
88 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
143 2643221561 Nocardioides sp. Root151 Isolate Unclassified
144 2643221576 Nocardioides sp. Root614 Isolate Unclassified
145 2643221590 Nocardioides sp. Root682 Isolate Unclassified
146 2643221604 Nocardioides sp. Root190 Isolate Unclassified
147 2643221615 Nocardioides sp. Root224 Isolate Unclassified
148 2643221617 Nocardioides sp. Root79 Isolate Unclassified
149 2643221620 Nocardioides sp. Root240 Isolate Unclassified
150 2643221641 Nocardioides sp. Root122 Isolate Unclassified
151 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
152 2643221696 Nocardioides sp. Root140 Isolate Unclassified
153 2738541305 Nocardioides sp. CF167 Isolate Unclassified
154 2739367898 Nocardioides sp. CF479 Isolate Unclassified
155 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
156 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
157 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
158 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
159 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
160 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.5
Metatranscriptomes 1.36
Isolates 8.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.9
Bulb 0
Endosphere 7.69
Nodule 0.45
Rhizoplane 5.43
Rhizosphere 76.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10057495 3300006038 Bacteria 2587
2 JGI24735J21928_10019184 3300002067 Bacteria 2103
3 Ga0006562J51391_1080807 3300003578 Bacteria 2186
4 Ga0070658_10015888 3300005327 Bacteria 6020
5 Ga0070658_10214953 3300005327 Bacteria 1625
6 Ga0070683_100001920 3300005329 Bacteria 16268
7 Ga0070683_100006495 3300005329 Bacteria 9819
8 Ga0070680_100050126 3300005336 Bacteria 3404
9 Ga0070682_100177275 3300005337 Bacteria 1486
10 Ga0070660_100107269 3300005339 Bacteria 2219
11 Ga0070687_100016993 3300005343 Bacteria 3335
12 Ga0070675_100073737 3300005354 Bacteria 2834
13 Ga0070659_100115271 3300005366 Bacteria 2172
14 Ga0070667_100082027 3300005367 Bacteria 2760
15 Ga0070684_100003935 3300005535 Bacteria 11252
16 Ga0068853_100077491 3300005539 Bacteria 2904
17 Ga0070686_100037920 3300005544 Bacteria 2993
18 Ga0070696_100099023 3300005546 Bacteria 2086
19 Ga0070693_100046411 3300005547 Bacteria 2467
20 Ga0070665_100001919 3300005548 Bacteria 23507
21 Ga0068857_100006218 3300005577 Bacteria 10209
22 Ga0068856_100092454 3300005614 Bacteria 3010
23 Ga0070702_100159471 3300005615 Bacteria 1457
24 Ga0068864_100116808 3300005618 Bacteria 2381
25 Ga0068858_100092003 3300005842 Bacteria 2823
26 Ga0068860_100150565 3300005843 Bacteria 2240
27 Ga0081455_10001547 3300005937 Bacteria 28322
28 Ga0081455_10034399 3300005937 Bacteria 4539
29 Ga0081538_10099721 3300005981 Bacteria 1467
30 Ga0081539_10018242 3300005985 Bacteria 4879
31 Ga0075365_10017316 3300006038 Bacteria 4406
32 Ga0075365_10068312 3300006038 Bacteria 2388
33 Ga0075364_10014640 3300006051 Bacteria 4850
34 Ga0075367_10072288 3300006178 Bacteria 2076
35 Ga0075370_10075230 3300006353 Bacteria 1936
36 Ga0075428_100008022 3300006844 Bacteria 11716
37 Ga0075430_100112607 3300006846 Bacteria 2268
38 Ga0075431_100004982 3300006847 Bacteria 13070
39 Ga0075431_100005712 3300006847 Bacteria 12293
40 Ga0075433_10374019 3300006852 Bacteria 1258
41 Ga0075429_100001616 3300006880 Bacteria 18607
42 Ga0068865_100133548 3300006881 Bacteria 1862
43 Ga0111539_10011430 3300009094 Bacteria 11143
44 Ga0111539_10439170 3300009094 Bacteria 1520
45 Ga0105245_10102795 3300009098 Bacteria 2646
46 Ga0105245_10266435 3300009098 Bacteria 1669
47 Ga0105243_10050649 3300009148 Bacteria 3282
48 Ga0105249_10011236 3300009553 Bacteria 7861
49 Ga0105239_10010065 3300010375 Bacteria 10599
50 Ga0105246_10003562 3300011119 Bacteria 9423
51 Ga0157372_10003814 3300013307 Bacteria 16192
52 Ga0157375_10029608 3300013308 Bacteria 5152
53 Ga0157375_10054500 3300013308 Bacteria 3938
54 Ga0163163_10009682 3300014325 Bacteria 8621
55 Ga0163163_10011030 3300014325 Bacteria 8171
56 Ga0157380_10207210 3300014326 Bacteria 1744
57 Ga0157379_10010363 3300014968 Bacteria 8121
58 Ga0163161_10039448 3300017792 Bacteria 3390
59 Ga0206353_10637874 3300020082 Bacteria 1961
60 Ga0213876_10099541 3300021384 Bacteria 1541
61 Ga0207688_10175845 3300025901 Bacteria 1275
62 Ga0207647_10060663 3300025904 Bacteria 2311
63 Ga0207643_10117896 3300025908 Bacteria 1570
64 Ga0207705_10021463 3300025909 Bacteria 4609
65 Ga0207705_10105142 3300025909 Bacteria 2081
66 Ga0207660_10074209 3300025917 Bacteria 2482
67 Ga0207662_10032124 3300025918 Bacteria 3053
68 Ga0207657_10029997 3300025919 Bacteria 4942
69 Ga0207657_10074969 3300025919 Bacteria 2856
70 Ga0207652_10006132 3300025921 Bacteria 9721
71 Ga0207690_10070949 3300025932 Bacteria 2401
72 Ga0207709_10028416 3300025935 Bacteria 3233
73 Ga0207709_10261619 3300025935 Bacteria 1269
74 Ga0207704_10121324 3300025938 Bacteria 1790
75 Ga0207704_10265782 3300025938 Bacteria 1296
76 Ga0207661_10006052 3300025944 Bacteria 8546
77 Ga0207661_10012731 3300025944 Bacteria 6127
78 Ga0207661_10030326 3300025944 Bacteria 4165
79 Ga0207658_10140245 3300025986 Bacteria 1955
80 Ga0207677_10047085 3300026023 Bacteria 2893
81 Ga0207703_10132540 3300026035 Bacteria 2154
82 Ga0207639_10103144 3300026041 Bacteria 2310
83 Ga0207708_10029364 3300026075 Bacteria 4167
84 Ga0207702_10019533 3300026078 Bacteria 5607
85 Ga0207674_10020246 3300026116 Bacteria 7193
86 Ga0207675_100158499 3300026118 Bacteria 2158
87 Ga0207683_10158107 3300026121 Bacteria 2048
88 Ga0268266_10001664 3300028379 Bacteria 25647
89 Ga0268266_10331195 3300028379 Bacteria 1427
90 Ga0307405_10137301 3300031731 Bacteria 1699
91 Ga0307405_10243879 3300031731 Bacteria 1333
92 Ga0307406_10148437 3300031901 Bacteria 1669
93 Ga0307407_10016501 3300031903 Bacteria 3678
94 Ga0307412_10017847 3300031911 Bacteria 4255
95 Ga0307412_10050560 3300031911 Bacteria 2743
96 Ga0307412_10191783 3300031911 Bacteria 1546
97 Ga0307409_100024449 3300031995 Bacteria 4213
98 Ga0307409_100036133 3300031995 Bacteria 3628
99 Ga0307409_100060912 3300031995 Bacteria 2946
100 Ga0307409_100293682 3300031995 Bacteria 1508
101 Ga0307416_100037376 3300032002 Bacteria 3735
102 Ga0307415_100001314 3300032126 Bacteria 11760
103 Ga0307415_100137936 3300032126 Bacteria 1858
104 Ga0395900_0145224 3300037418 Bacteria 2426
105 Ga0395905_0291736 3300037471 Bacteria 1518
106 Ga0395905_0350704 3300037471 Bacteria 1368
107 Ga0436364_0204215 3300037853 Bacteria 1457
108 Ga0395901_0069030 3300038443 Bacteria 3681
109 Ga0436365_1054591 3300039437 Bacteria 1541
110 Ga0439438_008621 3300041405 Bacteria 3363
111 Ga0451789_0405398 3300041443 Bacteria 1613
112 Ga0451793_0985681 3300041452 Bacteria 1816
113 Ga0451833_1109940 3300041491 Bacteria 4098
114 Ga0451837_0517678 3300041494 Bacteria 1676
115 Ga0466965_0008088 3300044683 Bacteria 4859
116 Ga0466970_0071086 3300044765 Bacteria 1871
117 Ga0466970_0074156 3300044765 Bacteria 1831
118 Ga0466957_0070323 3300044842 Bacteria 2163
119 Ga0466960_0038214 3300044901 Bacteria 2255
120 Ga0466960_0068576 3300044901 Bacteria 1760
121 Ga0466967_0010848 3300045976 Bacteria 6863
122 Ga0466967_0109628 3300045976 Bacteria 2534
123 Ga0466967_0259478 3300045976 Bacteria 1662
124 Ga0496102_0012229 3300048905 Bacteria 7422
125 Ga0496103_0191774 3300048906 Bacteria 1314
126 Ga0496106_0321423 3300048909 Bacteria 1242
127 Ga0496107_0137565 3300048910 Bacteria 1805
128 Ga0496107_0208717 3300048910 Bacteria 1452
129 Ga0496108_0184183 3300048911 Bacteria 1809
130 Ga0496110_0039226 3300048913 Bacteria 4123
131 Ga0496110_0186560 3300048913 Bacteria 1883
132 Ga0496111_0006238 3300048914 Bacteria 7728
133 Ga0496114_0047648 3300048917 Bacteria 3565
134 Ga0501310_000401 3300049130 Bacteria 3887
135 Ga0501031_0029983 3300049568 Bacteria 3548
136 Ga0501036_0091261 3300049572 Bacteria 2573
137 Ga0501036_0104373 3300049572 Bacteria 2397
138 Ga0501036_0217875 3300049572 Bacteria 1603
139 Ga0501037_0167750 3300049573 Bacteria 1562
140 Ga0501039_0055550 3300049575 Bacteria 3067
141 Ga0501039_0113811 3300049575 Bacteria 2116
142 Ga0501039_0156641 3300049575 Bacteria 1789
143 Ga0501040_0063716 3300049576 Bacteria 2537
144 Ga0501041_0044460 3300049577 Bacteria 2700
145 Ga0501042_0075110 3300049578 Bacteria 2418
146 Ga0501043_0253537 3300049579 Bacteria 1355
147 Ga0501046_0042538 3300049580 Bacteria 3622
148 Ga0501047_0226373 3300049581 Bacteria 1725
149 Ga0501048_0092576 3300049582 Bacteria 2132
150 Ga0501048_0213138 3300049582 Bacteria 1370
151 Ga0501067_0009326 3300049583 Bacteria 5438
152 Ga0501067_0038009 3300049583 Bacteria 2673
153 Ga0501067_0044047 3300049583 Bacteria 2480
154 Ga0501069_0003358 3300049585 Bacteria 8221
155 Ga0501069_0027540 3300049585 Bacteria 3114
156 Ga0501069_0034478 3300049585 Bacteria 2788
157 Ga0501070_0002205 3300049586 Bacteria 17102
158 Ga0501070_0075513 3300049586 Bacteria 2790
159 Ga0501071_0009053 3300049587 Bacteria 6608
160 Ga0501071_0026380 3300049587 Bacteria 4078
161 Ga0501071_0026994 3300049587 Bacteria 4037
162 Ga0501071_0029673 3300049587 Bacteria 3862
163 Ga0501071_0034044 3300049587 Bacteria 3623
164 Ga0501071_0296958 3300049587 Bacteria 1224
165 Ga0501072_0023298 3300049588 Bacteria 4808
166 Ga0501072_0030355 3300049588 Bacteria 4227
167 Ga0501072_0043019 3300049588 Bacteria 3550
168 Ga0501073_0026494 3300049589 Bacteria 4154
169 Ga0501073_0065507 3300049589 Bacteria 2533
170 Ga0501074_0003878 3300049590 Bacteria 10655
171 Ga0501075_0045634 3300049591 Bacteria 3290
172 Ga0501076_0016222 3300049592 Bacteria 5643
173 Ga0501076_0038750 3300049592 Bacteria 3742
174 Ga0501076_0329678 3300049592 Bacteria 1252
175 Ga0501079_0042546 3300049741 Bacteria 3507
176 Ga0501080_0029087 3300049742 Bacteria 5143
177 Ga0501080_0097045 3300049742 Bacteria 2736
178 Ga0501080_0101593 3300049742 Bacteria 2668
179 Ga0501080_0195986 3300049742 Bacteria 1855
180 Ga0501083_0015558 3300049744 Bacteria 5326
181 Ga0501083_0028773 3300049744 Bacteria 3828
182 Ga0501044_0230296 3300049823 Bacteria 1801
183 Ga0501045_0004991 3300049824 Bacteria 9194
184 nmdc:mga03n38_77783_c1 3300050490 Bacteria 1551
185 nmdc:mga00v17_66646_c1 3300050491 Bacteria 2223
186 nmdc:mga0yw44_10295_c1 3300050492 Bacteria 4770
187 nmdc:mga0yw44_103630_c1 3300050492 Bacteria 1815
188 nmdc:mga0yw44_130397_c1 3300050492 Bacteria 1627
189 nmdc:mga0yw44_41518_c1 3300050492 Bacteria 2739
190 nmdc:mga0yw44_71207_c1 3300050492 Bacteria 2158
191 nmdc:mga05p37_799_c1 3300050507 Bacteria 35097
192 nmdc:mga09592_492_c1 3300050508 Bacteria 29636
193 nmdc:mga06r32_427_c1 3300050510 Bacteria 35451
194 nmdc:mga0a205_237778_c1 3300050515 Bacteria 1703
195 Ga0495595_0024024 3300053084 Bacteria 2689
196 Ga0500566_0057716 3300053094 Bacteria 2205
197 Ga0500556_0000989 3300053104 Bacteria 15056
198 Ga0500593_000024 3300053117 Bacteria 52015
199 Ga0500573_0005315 3300053140 Bacteria 6890
200 Ga0501082_0069609 3300060353 Bacteria 3030
201 Ga0501082_0105338 3300060353 Bacteria 2440
202 Ga0530510_0108790 3300061734 Bacteria 2029
203 Ga0530510_0136016 3300061734 Bacteria 1809
204 2643827107 2643221561 Bacteria 4984412
205 2643891090 2643221576 Bacteria 5214352
206 2643960146 2643221590 Bacteria 5214697
207 2644035087 2643221604 Bacteria 5014917
208 2644092331 2643221615 Bacteria 5487866
209 2644101238 2643221617 Bacteria 5139111
210 2644119356 2643221620 Bacteria 5134593
211 2644231737 2643221641 Bacteria 4490190
212 2644322134 2643221657 Bacteria 5490246
213 2644534460 2643221696 Bacteria 5431823
214 2738868835 2738541305 Bacteria 4910150
215 2740165449 2739367898 Bacteria 4367674
216 2812330253 2811994874 Bacteria 5367947
217 2855388528 2855386786 Bacteria 4752232
218 2857484181 2857481737 Bacteria 4761446
219 2984578165 2984576629 Bacteria 4248407
220 2990257678 2990256926 Bacteria 4252839
221 8054611838 8054609563 Bacteria 5170090
222 Ga0075365_10057495
223 JGI24735J21928_10019184
224 Ga0006562J51391_1080807
225 Ga0070658_10015888
226 Ga0070658_10214953
227 Ga0070683_100001920
228 Ga0070683_100006495
229 Ga0070680_100050126
230 Ga0070682_100177275
231 Ga0070660_100107269
232 Ga0070687_100016993
233 Ga0070675_100073737
234 Ga0070659_100115271
235 Ga0070667_100082027
236 Ga0070684_100003935
237 Ga0068853_100077491
238 Ga0070686_100037920
239 Ga0070696_100099023
240 Ga0070693_100046411
241 Ga0070665_100001919
242 Ga0068857_100006218
243 Ga0068856_100092454
244 Ga0070702_100159471
245 Ga0068864_100116808
246 Ga0068858_100092003
247 Ga0068860_100150565
248 Ga0081455_10001547
249 Ga0081455_10034399
250 Ga0081538_10099721
251 Ga0081539_10018242
252 Ga0075365_10017316
253 Ga0075365_10068312
254 Ga0075364_10014640
255 Ga0075367_10072288
256 Ga0075370_10075230
257 Ga0075428_100008022
258 Ga0075430_100112607
259 Ga0075431_100004982
260 Ga0075431_100005712
261 Ga0075433_10374019
262 Ga0075429_100001616
263 Ga0068865_100133548
264 Ga0111539_10011430
265 Ga0111539_10439170
266 Ga0105245_10102795
267 Ga0105245_10266435
268 Ga0105243_10050649
269 Ga0105249_10011236
270 Ga0105239_10010065
271 Ga0105246_10003562
272 Ga0157372_10003814
273 Ga0157375_10029608
274 Ga0157375_10054500
275 Ga0163163_10009682
276 Ga0163163_10011030
277 Ga0157380_10207210
278 Ga0157379_10010363
279 Ga0163161_10039448
280 Ga0206353_10637874
281 Ga0213876_10099541
282 Ga0207688_10175845
283 Ga0207647_10060663
284 Ga0207643_10117896
285 Ga0207705_10021463
286 Ga0207705_10105142
287 Ga0207660_10074209
288 Ga0207662_10032124
289 Ga0207657_10029997
290 Ga0207657_10074969
291 Ga0207652_10006132
292 Ga0207690_10070949
293 Ga0207709_10028416
294 Ga0207709_10261619
295 Ga0207704_10121324
296 Ga0207704_10265782
297 Ga0207661_10006052
298 Ga0207661_10012731
299 Ga0207661_10030326
300 Ga0207658_10140245
301 Ga0207677_10047085
302 Ga0207703_10132540
303 Ga0207639_10103144
304 Ga0207708_10029364
305 Ga0207702_10019533
306 Ga0207674_10020246
307 Ga0207675_100158499
308 Ga0207683_10158107
309 Ga0268266_10001664
310 Ga0268266_10331195
311 Ga0307405_10137301
312 Ga0307405_10243879
313 Ga0307406_10148437
314 Ga0307407_10016501
315 Ga0307412_10017847
316 Ga0307412_10050560
317 Ga0307412_10191783
318 Ga0307409_100024449
319 Ga0307409_100036133
320 Ga0307409_100060912
321 Ga0307409_100293682
322 Ga0307416_100037376
323 Ga0307415_100001314
324 Ga0307415_100137936
325 Ga0395900_0145224
326 Ga0395905_0291736
327 Ga0395905_0350704
328 Ga0436364_0204215
329 Ga0395901_0069030
330 Ga0436365_1054591
331 Ga0439438_008621
332 Ga0451789_0405398
333 Ga0451793_0985681
334 Ga0451833_1109940
335 Ga0451837_0517678
336 Ga0466965_0008088
337 Ga0466970_0071086
338 Ga0466970_0074156
339 Ga0466957_0070323
340 Ga0466960_0038214
341 Ga0466960_0068576
342 Ga0466967_0010848
343 Ga0466967_0109628
344 Ga0466967_0259478
345 Ga0496102_0012229
346 Ga0496103_0191774
347 Ga0496106_0321423
348 Ga0496107_0137565
349 Ga0496107_0208717
350 Ga0496108_0184183
351 Ga0496110_0039226
352 Ga0496110_0186560
353 Ga0496111_0006238
354 Ga0496114_0047648
355 Ga0501310_000401
356 Ga0501031_0029983
357 Ga0501036_0091261
358 Ga0501036_0104373
359 Ga0501036_0217875
360 Ga0501037_0167750
361 Ga0501039_0055550
362 Ga0501039_0113811
363 Ga0501039_0156641
364 Ga0501040_0063716
365 Ga0501041_0044460
366 Ga0501042_0075110
367 Ga0501043_0253537
368 Ga0501046_0042538
369 Ga0501047_0226373
370 Ga0501048_0092576
371 Ga0501048_0213138
372 Ga0501067_0009326
373 Ga0501067_0038009
374 Ga0501067_0044047
375 Ga0501069_0003358
376 Ga0501069_0027540
377 Ga0501069_0034478
378 Ga0501070_0002205
379 Ga0501070_0075513
380 Ga0501071_0009053
381 Ga0501071_0026380
382 Ga0501071_0026994
383 Ga0501071_0029673
384 Ga0501071_0034044
385 Ga0501071_0296958
386 Ga0501072_0023298
387 Ga0501072_0030355
388 Ga0501072_0043019
389 Ga0501073_0026494
390 Ga0501073_0065507
391 Ga0501074_0003878
392 Ga0501075_0045634
393 Ga0501076_0016222
394 Ga0501076_0038750
395 Ga0501076_0329678
396 Ga0501079_0042546
397 Ga0501080_0029087
398 Ga0501080_0097045
399 Ga0501080_0101593
400 Ga0501080_0195986
401 Ga0501083_0015558
402 Ga0501083_0028773
403 Ga0501044_0230296
404 Ga0501045_0004991
405 nmdc:mga03n38_77783_c1
406 nmdc:mga00v17_66646_c1
407 nmdc:mga0yw44_10295_c1
408 nmdc:mga0yw44_103630_c1
409 nmdc:mga0yw44_130397_c1
410 nmdc:mga0yw44_41518_c1
411 nmdc:mga0yw44_71207_c1
412 nmdc:mga05p37_799_c1
413 nmdc:mga09592_492_c1
414 nmdc:mga06r32_427_c1
415 nmdc:mga0a205_237778_c1
416 Ga0495595_0024024
417 Ga0500566_0057716
418 Ga0500556_0000989
419 Ga0500593_000024
420 Ga0500573_0005315
421 Ga0501082_0069609
422 Ga0501082_0105338
423 Ga0530510_0108790
424 Ga0530510_0136016
425 2643827107
426 2643891090
427 2643960146
428 2644035087
429 2644092331
430 2644101238
431 2644119356
432 2644231737
433 2644322134
434 2644534460
435 2738868835
436 2740165449
437 2812330253
438 2855388528
439 2857484181
440 2984578165
441 2990257678
442 8054611838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

7

230

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kio-assembly1.cif.gz_A mouse rnase h2 complex 0.8074 163 207
4ils-assembly2.cif.gz_B crystal structure of engineered protein. northeast structural genomics consortium target or117 0.7794 5 333
4ils-assembly1.cif.gz_A crystal structure of engineered protein. northeast structural genomics consortium target or117 0.7772 5 333
3uw6-assembly1.cif.gz_B crystal structure of engineered protein, northeast structural genomics consortium target or120 0.774 3 333
4ils-assembly2.cif.gz_C crystal structure of engineered protein. northeast structural genomics consortium target or117 0.7691 5 348
ID Description Score Start End Superfamily
af_C6KT75_7_189_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8082 163 207 3.30.420.10
4ilsB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8044 10 210 3.20.20.10
1vftA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.7862 10 208 3.20.20.10
4ilsB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.785 10 210 3.20.20.10
5yycC02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.7837 11 208 3.20.20.10
ID Description Score Start End GO Terms
AF-A1SQT4-F1-model_v4 Alanine racemase domain protein 0.9723 1 348 GO:0003824
AF-A1SQT4-F1-model_v4 Alanine racemase domain protein 0.9695 1 348 GO:0003824
AF-A0A1T4YZC2-F1-model_v4 Alanine racemase 0.966 1 348 GO:0005829
GO:0008784
GO:0030170
AF-A0A1T4YZC2-F1-model_v4 Alanine racemase 0.9633 1 348 GO:0005829
GO:0008784
GO:0030170
AF-E2S8N1-F1-model_v4 Alanine racemase domain protein 0.9621 1 348 GO:0003824

Map