F333011

General Info

Members Datasets Scaffolds Average Seq Length
221 146 438 300

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100232220|Ga0070682_1002322201
Length 325
Sequence MTRTGMIATLHYLQPSYRERTHMYDEEPIVDAHHHLWDLEGDVRYPWLKQADPHHSYMGDNSALRRSYLPEEYRRDTALHNVVATVHIEAECDRAQQVAETRWLSGLAARYGMPSAIVAHAWIDTPDAEEILLQHKQWPLVRGIRTKPIISDGPDTSVRGLPRSMQDPKWRNGLSLLEKHDLSWDLRVVWWHLEEAAEVAHEHPGLRTVLNHTGYPLDRSPEALAVWRRGMEALAACPNVWCKISGLTVKGEPWTLAANRPVIRDAIRIFGVDRCMFASNFPVDGLKGSWDYLYSQFKRAVADLPLGDRRKLFAENAARFYRIAI

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
79 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
80 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
81 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
139 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
144 2643221649 Leifsonia sp. Root4 Isolate Unclassified
145 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
146 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0
Isolates 1.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 3.62
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 8.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100232220 3300005337 Unclassified 1319
2 JGI25405J52794_10016487 3300003911 Bacteria 1460
3 Ga0070658_10011537 3300005327 Bacteria 7087
4 Ga0070683_100351900 3300005329 Bacteria 1403
5 Ga0070670_100161463 3300005331 Bacteria 1942
6 Ga0070689_100132182 3300005340 Unclassified 2002
7 Ga0070691_10064339 3300005341 Bacteria 1770
8 Ga0070700_100035226 3300005441 Unclassified 3028
9 Ga0070700_100099323 3300005441 Bacteria 1915
10 Ga0070694_100040242 3300005444 Bacteria 3115
11 Ga0070663_100153032 3300005455 Bacteria 1770
12 Ga0070679_100002254 3300005530 Bacteria 17417
13 Ga0070684_100008803 3300005535 Bacteria 7913
14 Ga0070695_100006039 3300005545 Bacteria 7152
15 Ga0070695_100025491 3300005545 Bacteria 3652
16 Ga0070696_100315407 3300005546 Bacteria 1202
17 Ga0070704_100205063 3300005549 Bacteria 1594
18 Ga0070704_100252030 3300005549 Unclassified 1450
19 Ga0068855_100067460 3300005563 Bacteria 4167
20 Ga0070702_100152930 3300005615 Bacteria 1483
21 Ga0068859_100022283 3300005617 Bacteria 6352
22 Ga0068863_100466798 3300005841 Bacteria 1240
23 Ga0081455_10000686 3300005937 Bacteria 43985
24 Ga0081540_1000179 3300005983 Bacteria 65936
25 Ga0070715_10133264 3300006163 Bacteria 1198
26 Ga0075428_100061021 3300006844 Bacteria 4128
27 Ga0075428_100241348 3300006844 Bacteria 1949
28 Ga0075431_100033354 3300006847 Bacteria 5307
29 Ga0075431_100081325 3300006847 Bacteria 3345
30 Ga0075433_10007591 3300006852 Bacteria 8607
31 Ga0075434_100001671 3300006871 Bacteria 18925
32 Ga0075429_100104569 3300006880 Bacteria 2473
33 Ga0097620_100022282 3300006931 Bacteria 6352
34 Ga0075435_100023542 3300007076 Bacteria 4765
35 Ga0075435_100052828 3300007076 Plasmid 3275
36 Ga0075435_100318450 3300007076 Bacteria 1331
37 Ga0105240_10054593 3300009093 Bacteria 5007
38 Ga0111539_10126323 3300009094 Bacteria 2996
39 Ga0105245_10020553 3300009098 Bacteria 5790
40 Ga0114129_10232544 3300009147 Bacteria 2482
41 Ga0114129_10607958 3300009147 Bacteria 1416
42 Ga0114129_10689822 3300009147 Bacteria 1314
43 Ga0105243_10251890 3300009148 Bacteria 1577
44 Ga0105242_10085295 3300009176 Bacteria 2648
45 Ga0105248_10241365 3300009177 Bacteria 2034
46 Ga0105237_10010048 3300009545 Bacteria 10094
47 Ga0105238_10181496 3300009551 Unclassified 2081
48 Ga0105239_10059958 3300010375 Bacteria 4175
49 Ga0157370_10027727 3300013104 Bacteria 5584
50 Ga0157370_10265913 3300013104 Bacteria 1585
51 Ga0157369_10007535 3300013105 Bacteria 12524
52 Ga0157369_10127325 3300013105 Bacteria 2699
53 Ga0157372_10029288 3300013307 Bacteria 6011
54 Ga0157379_10082614 3300014968 Bacteria 2879
55 Ga0163161_10279840 3300017792 Unclassified 1308
56 Ga0209051_1022056 3300025303 Bacteria 2692
57 Ga0207707_10222646 3300025912 Unclassified 1642
58 Ga0207707_10331062 3300025912 Bacteria 1314
59 Ga0207695_10056174 3300025913 Bacteria 4098
60 Ga0207652_10065660 3300025921 Plasmid 3143
61 Ga0207686_10000783 3300025934 Bacteria 19543
62 Ga0207670_10141876 3300025936 Unclassified 1772
63 Ga0207661_10093599 3300025944 Plasmid 2508
64 Ga0207667_10040270 3300025949 Bacteria 4976
65 Ga0207712_10160543 3300025961 Bacteria 1746
66 Ga0207678_10201230 3300026067 Bacteria 1703
67 Ga0207708_10147948 3300026075 Unclassified 1847
68 Ga0207675_100028807 3300026118 Bacteria 5173
69 Ga0209967_1009810 3300027364 Unclassified 1329
70 Ga0210000_1004124 3300027462 Bacteria 2100
71 Ga0210000_1016782 3300027462 Unclassified 1107
72 Ga0209966_1000824 3300027695 Bacteria 6081
73 Ga0207428_10254672 3300027907 Bacteria 1308
74 Ga0265338_10021618 3300028800 Bacteria 6700
75 Ga0265338_10025620 3300028800 Bacteria 5979
76 Ga0265331_10000303 3300031250 Bacteria 53811
77 Ga0265327_10000007 3300031251 Bacteria 678515
78 Ga0316576_10100435 3300031727 Bacteria 2162
79 Ga0307405_10041207 3300031731 Bacteria 2802
80 Ga0307405_10192892 3300031731 Bacteria 1473
81 Ga0307413_10058373 3300031824 Bacteria 2365
82 Ga0307406_10004799 3300031901 Bacteria 7365
83 Ga0307407_10006158 3300031903 Bacteria 5299
84 Ga0307412_10063520 3300031911 Unclassified 2491
85 Ga0307409_100004147 3300031995 Bacteria 8064
86 Ga0307409_100166529 3300031995 Bacteria 1935
87 Ga0307409_100412126 3300031995 Bacteria 1294
88 Ga0307416_100246958 3300032002 Bacteria 1734
89 Ga0307416_100287774 3300032002 Bacteria 1625
90 Ga0307416_100352972 3300032002 Bacteria 1489
91 Ga0307416_100364813 3300032002 Bacteria 1468
92 Ga0307416_100717723 3300032002 Unclassified 1090
93 Ga0307415_100006744 3300032126 Bacteria 6223
94 Ga0373934_0008851 3300035086 Bacteria 3762
95 Ga0373923_0095671 3300035111 Bacteria 1304
96 Ga0373939_0005110 3300035114 Bacteria 3120
97 Ga0373953_0109729 3300035117 Bacteria 1166
98 Ga0373954_0000003 3300035118 Bacteria 137757
99 Ga0373960_0000814 3300035121 Bacteria 6551
100 Ga0373960_0005342 3300035121 Bacteria 2970
101 Ga0373942_0022521 3300035207 Bacteria 1599
102 Ga0373942_0047706 3300035207 Bacteria 1191
103 Ga0373962_0002987 3300035242 Bacteria 4056
104 Ga0316574_0009689 3300035398 Bacteria 5408
105 Ga0316574_0059405 3300035398 Bacteria 2398
106 Ga0373931_0000581 3300035691 Bacteria 15090
107 Ga0373931_0001023 3300035691 Bacteria 11798
108 Ga0373933_0001870 3300035724 Bacteria 12159
109 Ga0373937_0000131 3300036401 Bacteria 72767
110 Ga0373937_0083120 3300036401 Bacteria 2962
111 Ga0400483_036353 3300039062 Bacteria 2776
112 Ga0400483_191556 3300039062 Bacteria 7263
113 Ga0436365_1654463 3300039437 Bacteria 10856
114 Ga0436360_0346234 3300039438 Bacteria 2858
115 Ga0436361_0533082 3300039447 Bacteria 2431
116 Ga0439441_008067 3300042001 Bacteria 1712
117 Ga0466965_0112672 3300044683 Bacteria 1399
118 Ga0466963_0189636 3300044694 Bacteria 1436
119 Ga0451576_0000231 3300045051 Bacteria 136040
120 Ga0495584_0049622 3300046491 Bacteria 2115
121 Ga0495587_0193637 3300046536 Bacteria 1151
122 Ga0495667_0078876 3300046559 Bacteria 2141
123 Ga0495657_0026043 3300046675 Bacteria 4147
124 Ga0496102_0492819 3300048905 Bacteria 1147
125 Ga0496104_0028573 3300048907 Bacteria 5169
126 Ga0496107_0202840 3300048910 Bacteria 1474
127 Ga0496108_0146049 3300048911 Bacteria 2039
128 Ga0496109_0013373 3300048912 Bacteria 7116
129 Ga0496110_0012170 3300048913 Bacteria 7069
130 Ga0496114_0346219 3300048917 Bacteria 1314
131 Ga0496115_0000849 3300048918 Bacteria 22201
132 Ga0501032_0053294 3300049569 Bacteria 2725
133 Ga0501033_0014786 3300049570 Bacteria 5925
134 Ga0501034_0166069 3300049571 Bacteria 2176
135 Ga0501036_0007782 3300049572 Bacteria 8764
136 Ga0501036_0039407 3300049572 Bacteria 3998
137 Ga0501038_0009079 3300049574 Bacteria 9127
138 Ga0501038_0107831 3300049574 Bacteria 2310
139 Ga0501039_0001555 3300049575 Bacteria 16884
140 Ga0501039_0032402 3300049575 Bacteria 4029
141 Ga0501039_0063017 3300049575 Bacteria 2873
142 Ga0501039_0069773 3300049575 Bacteria 2730
143 Ga0501040_0001309 3300049576 Bacteria 15786
144 Ga0501040_0009335 3300049576 Bacteria 6390
145 Ga0501040_0069803 3300049576 Bacteria 2424
146 Ga0501040_0086309 3300049576 Unclassified 2179
147 Ga0501040_0096951 3300049576 Bacteria 2054
148 Ga0501041_0001663 3300049577 Bacteria 12444
149 Ga0501041_0004474 3300049577 Bacteria 8097
150 Ga0501041_0011390 3300049577 Bacteria 5255
151 Ga0501041_0036610 3300049577 Bacteria 2973
152 Ga0501042_0000903 3300049578 Bacteria 16594
153 Ga0501043_0020871 3300049579 Bacteria 5138
154 Ga0501046_0004807 3300049580 Bacteria 12176
155 Ga0501048_0052513 3300049582 Bacteria 2901
156 Ga0501068_0037692 3300049584 Bacteria 2894
157 Ga0501070_0013111 3300049586 Bacteria 6987
158 Ga0501070_0097004 3300049586 Bacteria 2439
159 Ga0501071_0000232 3300049587 Bacteria 25461
160 Ga0501071_0003105 3300049587 Bacteria 10310
161 Ga0501072_0001445 3300049588 Bacteria 17816
162 Ga0501072_0009107 3300049588 Bacteria 7538
163 Ga0501072_0012367 3300049588 Bacteria 6522
164 Ga0501072_0248782 3300049588 Bacteria 1416
165 Ga0501074_0000394 3300049590 Bacteria 25979
166 Ga0501074_0023306 3300049590 Bacteria 4502
167 Ga0501075_0000149 3300049591 Bacteria 34951
168 Ga0501075_0002025 3300049591 Bacteria 13402
169 Ga0501075_0045504 3300049591 Bacteria 3294
170 Ga0501075_0060487 3300049591 Bacteria 2854
171 Ga0501076_0002057 3300049592 Bacteria 13783
172 Ga0501076_0024215 3300049592 Bacteria 4689
173 Ga0501076_0045654 3300049592 Bacteria 3459
174 Ga0501077_0000552 3300049593 Bacteria 22746
175 Ga0501077_0227955 3300049593 Bacteria 1184
176 Ga0501079_0000793 3300049741 Bacteria 21523
177 Ga0501079_0187909 3300049741 Bacteria 1612
178 Ga0501080_0007806 3300049742 Bacteria 9678
179 Ga0501080_0010153 3300049742 Bacteria 8610
180 Ga0501080_0121699 3300049742 Bacteria 2418
181 Ga0501081_0000129 3300049743 Bacteria 33283
182 Ga0501081_0022455 3300049743 Bacteria 4223
183 Ga0501081_0153704 3300049743 Bacteria 1654
184 Ga0501083_0009311 3300049744 Bacteria 6935
185 Ga0501045_0005458 3300049824 Bacteria 8803
186 Ga0501045_0011819 3300049824 Bacteria 6133
187 Ga0501045_0110487 3300049824 Bacteria 2038
188 Ga0501045_0238285 3300049824 Bacteria 1354
189 nmdc:mga05p37_113621_c1 3300050507 Unclassified 3329
190 nmdc:mga05p37_24137_c1 3300050507 Bacteria 7387
191 nmdc:mga05p37_357110_c1 3300050507 Bacteria 1719
192 nmdc:mga05p37_508887_c1 3300050507 Bacteria 1380
193 nmdc:mga09592_37979_c1 3300050508 Bacteria 4041
194 nmdc:mga0qj67_26584_c1 3300050509 Bacteria 4480
195 nmdc:mga0qj67_393632_c1 3300050509 Unclassified 1118
196 nmdc:mga06r32_24950_c1 3300050510 Bacteria 5555
197 nmdc:mga06r32_304206_c1 3300050510 Bacteria 1580
198 nmdc:mga08y16_151328_c1 3300050511 Bacteria 2412
199 nmdc:mga08y16_255771_c1 3300050511 Unclassified 1809
200 nmdc:mga08y16_275944_c1 3300050511 Unclassified 1735
201 nmdc:mga0n895_12731_c1 3300050512 Bacteria 7554
202 nmdc:mga0n895_14008_c1 3300050512 Bacteria 7263
203 nmdc:mga0rr50_36467_c1 3300050513 Bacteria 3541
204 nmdc:mga0a205_6714_c1 3300050515 Bacteria 10408
205 Ga0500643_000275 3300053087 Bacteria 44588
206 Ga0500650_0012384 3300053098 Bacteria 3546
207 Ga0500573_0066123 3300053140 Bacteria 2067
208 Ga0501084_0000636 3300054114 Bacteria 26771
209 Ga0501084_0057880 3300054114 Bacteria 3243
210 Ga0501084_0157085 3300054114 Bacteria 1918
211 Ga0501082_0041555 3300060353 Bacteria 3964
212 Ga0501082_0431481 3300060353 Unclassified 1151
213 Ga0501082_0521689 3300060353 Bacteria 1038
214 Ga0530510_0001930 3300061734 Bacteria 14188
215 Ga0530510_0069203 3300061734 Bacteria 2561
216 Ga0530510_0135265 3300061734 Bacteria 1814
217 2644278097 2643221649 Bacteria 3867359
218 2870622473 2870622029 Bacteria 3643329
219 2939663407 2939660829 Bacteria 3784848
220 Ga0070682_100232220
221 JGI25405J52794_10016487
222 Ga0070658_10011537
223 Ga0070683_100351900
224 Ga0070670_100161463
225 Ga0070689_100132182
226 Ga0070691_10064339
227 Ga0070700_100035226
228 Ga0070700_100099323
229 Ga0070694_100040242
230 Ga0070663_100153032
231 Ga0070679_100002254
232 Ga0070684_100008803
233 Ga0070695_100006039
234 Ga0070695_100025491
235 Ga0070696_100315407
236 Ga0070704_100205063
237 Ga0070704_100252030
238 Ga0068855_100067460
239 Ga0070702_100152930
240 Ga0068859_100022283
241 Ga0068863_100466798
242 Ga0081455_10000686
243 Ga0081540_1000179
244 Ga0070715_10133264
245 Ga0075428_100061021
246 Ga0075428_100241348
247 Ga0075431_100033354
248 Ga0075431_100081325
249 Ga0075433_10007591
250 Ga0075434_100001671
251 Ga0075429_100104569
252 Ga0097620_100022282
253 Ga0075435_100023542
254 Ga0075435_100052828
255 Ga0075435_100318450
256 Ga0105240_10054593
257 Ga0111539_10126323
258 Ga0105245_10020553
259 Ga0114129_10232544
260 Ga0114129_10607958
261 Ga0114129_10689822
262 Ga0105243_10251890
263 Ga0105242_10085295
264 Ga0105248_10241365
265 Ga0105237_10010048
266 Ga0105238_10181496
267 Ga0105239_10059958
268 Ga0157370_10027727
269 Ga0157370_10265913
270 Ga0157369_10007535
271 Ga0157369_10127325
272 Ga0157372_10029288
273 Ga0157379_10082614
274 Ga0163161_10279840
275 Ga0209051_1022056
276 Ga0207707_10222646
277 Ga0207707_10331062
278 Ga0207695_10056174
279 Ga0207652_10065660
280 Ga0207686_10000783
281 Ga0207670_10141876
282 Ga0207661_10093599
283 Ga0207667_10040270
284 Ga0207712_10160543
285 Ga0207678_10201230
286 Ga0207708_10147948
287 Ga0207675_100028807
288 Ga0209967_1009810
289 Ga0210000_1004124
290 Ga0210000_1016782
291 Ga0209966_1000824
292 Ga0207428_10254672
293 Ga0265338_10021618
294 Ga0265338_10025620
295 Ga0265331_10000303
296 Ga0265327_10000007
297 Ga0316576_10100435
298 Ga0307405_10041207
299 Ga0307405_10192892
300 Ga0307413_10058373
301 Ga0307406_10004799
302 Ga0307407_10006158
303 Ga0307412_10063520
304 Ga0307409_100004147
305 Ga0307409_100166529
306 Ga0307409_100412126
307 Ga0307416_100246958
308 Ga0307416_100287774
309 Ga0307416_100352972
310 Ga0307416_100364813
311 Ga0307416_100717723
312 Ga0307415_100006744
313 Ga0373934_0008851
314 Ga0373923_0095671
315 Ga0373939_0005110
316 Ga0373953_0109729
317 Ga0373954_0000003
318 Ga0373960_0000814
319 Ga0373960_0005342
320 Ga0373942_0022521
321 Ga0373942_0047706
322 Ga0373962_0002987
323 Ga0316574_0009689
324 Ga0316574_0059405
325 Ga0373931_0000581
326 Ga0373931_0001023
327 Ga0373933_0001870
328 Ga0373937_0000131
329 Ga0373937_0083120
330 Ga0400483_036353
331 Ga0400483_191556
332 Ga0436365_1654463
333 Ga0436360_0346234
334 Ga0436361_0533082
335 Ga0439441_008067
336 Ga0466965_0112672
337 Ga0466963_0189636
338 Ga0451576_0000231
339 Ga0495584_0049622
340 Ga0495587_0193637
341 Ga0495667_0078876
342 Ga0495657_0026043
343 Ga0496102_0492819
344 Ga0496104_0028573
345 Ga0496107_0202840
346 Ga0496108_0146049
347 Ga0496109_0013373
348 Ga0496110_0012170
349 Ga0496114_0346219
350 Ga0496115_0000849
351 Ga0501032_0053294
352 Ga0501033_0014786
353 Ga0501034_0166069
354 Ga0501036_0007782
355 Ga0501036_0039407
356 Ga0501038_0009079
357 Ga0501038_0107831
358 Ga0501039_0001555
359 Ga0501039_0032402
360 Ga0501039_0063017
361 Ga0501039_0069773
362 Ga0501040_0001309
363 Ga0501040_0009335
364 Ga0501040_0069803
365 Ga0501040_0086309
366 Ga0501040_0096951
367 Ga0501041_0001663
368 Ga0501041_0004474
369 Ga0501041_0011390
370 Ga0501041_0036610
371 Ga0501042_0000903
372 Ga0501043_0020871
373 Ga0501046_0004807
374 Ga0501048_0052513
375 Ga0501068_0037692
376 Ga0501070_0013111
377 Ga0501070_0097004
378 Ga0501071_0000232
379 Ga0501071_0003105
380 Ga0501072_0001445
381 Ga0501072_0009107
382 Ga0501072_0012367
383 Ga0501072_0248782
384 Ga0501074_0000394
385 Ga0501074_0023306
386 Ga0501075_0000149
387 Ga0501075_0002025
388 Ga0501075_0045504
389 Ga0501075_0060487
390 Ga0501076_0002057
391 Ga0501076_0024215
392 Ga0501076_0045654
393 Ga0501077_0000552
394 Ga0501077_0227955
395 Ga0501079_0000793
396 Ga0501079_0187909
397 Ga0501080_0007806
398 Ga0501080_0010153
399 Ga0501080_0121699
400 Ga0501081_0000129
401 Ga0501081_0022455
402 Ga0501081_0153704
403 Ga0501083_0009311
404 Ga0501045_0005458
405 Ga0501045_0011819
406 Ga0501045_0110487
407 Ga0501045_0238285
408 nmdc:mga05p37_113621_c1
409 nmdc:mga05p37_24137_c1
410 nmdc:mga05p37_357110_c1
411 nmdc:mga05p37_508887_c1
412 nmdc:mga09592_37979_c1
413 nmdc:mga0qj67_26584_c1
414 nmdc:mga0qj67_393632_c1
415 nmdc:mga06r32_24950_c1
416 nmdc:mga06r32_304206_c1
417 nmdc:mga08y16_151328_c1
418 nmdc:mga08y16_255771_c1
419 nmdc:mga08y16_275944_c1
420 nmdc:mga0n895_12731_c1
421 nmdc:mga0n895_14008_c1
422 nmdc:mga0rr50_36467_c1
423 nmdc:mga0a205_6714_c1
424 Ga0500643_000275
425 Ga0500650_0012384
426 Ga0500573_0066123
427 Ga0501084_0000636
428 Ga0501084_0057880
429 Ga0501084_0157085
430 Ga0501082_0041555
431 Ga0501082_0431481
432 Ga0501082_0521689
433 Ga0530510_0001930
434 Ga0530510_0069203
435 Ga0530510_0135265
436 2644278097
437 2870622473
438 2939663407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

30

323

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.8574 7 302
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.849 7 302
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.8449 7 302
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.8365 7 302
6uvz-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8262 5 302
ID Description Score Start End Superfamily
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8449 7 302 3.20.20.140
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8365 7 302 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8001 7 301 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7947 3 300 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.792 7 301 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A849TED6-F1-model_v4 Amidohydrolase family protein 0.9893 1 303 GO:0016787
AF-A0A2E5PLS4-F1-model_v4 Amidohydrolase 0.9834 1 303 GO:0016787
AF-A0A7H0HD40-F1-model_v4 Amidohydrolase family protein 0.9829 5 303 GO:0016787
AF-A0A3D3XAM9-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9828 156 301 GO:0016787
AF-A0A382XIW7-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9825 175 301 GO:0016787

Map