F332913

General Info

Members Datasets Scaffolds Average Seq Length
221 142 442 254

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10005617|JGI25407J50210_100056175
Length 285
Sequence MDTGRFGQTGSPHPSGDPVWTSRRLRRQISQARVTVWASWALPHPTLVWAIAAAWAVAVAAEMTGRGQLLHHDALAGGGLPPWAALGLFLLAWQLMIVAMMLPSSLPLIRLFDRVAANQPRPLRAKAAFLGGYAGVWTGFGAAAFLGDLAIHLLVDRWEWLAARPSLIGGAVLLLAGGFQFSNLKDRCLRVCRHPGGYLXQHYRRGTSAAFRLGVGHGVFCLGCCWALMLVAFAAGVATLWWMAALTAVMVFEKTGQGGRRGVRPIGVGLIVLGLMLAATAAGSP

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
93 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.71
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10005617 3300003373 Bacteria 3092
2 JGI25407J50210_10002364 3300003373 Bacteria 4433
3 JGI25407J50210_10006529 3300003373 Bacteria 2908
4 JGI25407J50210_10007148 3300003373 Bacteria 2794
5 JGI25407J50210_10024814 3300003373 Bacteria 1555
6 Ga0070670_100013991 3300005331 Bacteria 6881
7 Ga0068869_100239964 3300005334 Bacteria 1444
8 Ga0070682_100046462 3300005337 Bacteria 2694
9 Ga0070687_100036425 3300005343 Bacteria 2452
10 Ga0070661_100067111 3300005344 Bacteria 2636
11 Ga0070668_100028661 3300005347 Bacteria 4225
12 Ga0070675_100064784 3300005354 Bacteria 3021
13 Ga0070673_100059346 3300005364 Bacteria 3028
14 Ga0070688_100028966 3300005365 Bacteria 3311
15 Ga0070659_100022555 3300005366 Bacteria 4807
16 Ga0070659_100384233 3300005366 Bacteria 1183
17 Ga0070713_100207085 3300005436 Bacteria 1774
18 Ga0070705_100080946 3300005440 Bacteria 1994
19 Ga0070700_100033588 3300005441 Bacteria 3091
20 Ga0070700_100359966 3300005441 Bacteria 1081
21 Ga0070708_100006313 3300005445 Bacteria 9433
22 Ga0070708_100022480 3300005445 Bacteria 5350
23 Ga0070678_100125156 3300005456 Bacteria 2033
24 Ga0068867_100134620 3300005459 Bacteria 1925
25 Ga0070685_10008905 3300005466 Bacteria 5176
26 Ga0070686_100001762 3300005544 Bacteria 12119
27 Ga0070696_100217992 3300005546 Bacteria 1431
28 Ga0070704_100084655 3300005549 Bacteria 2345
29 Ga0070704_100164708 3300005549 Bacteria 1757
30 Ga0068855_100218489 3300005563 Bacteria 2138
31 Ga0070664_100018940 3300005564 Bacteria 5660
32 Ga0070664_100270999 3300005564 Bacteria 1529
33 Ga0068857_100067098 3300005577 Bacteria 3193
34 Ga0068857_100072830 3300005577 Bacteria 3061
35 Ga0068856_100091328 3300005614 Bacteria 3029
36 Ga0070702_100020966 3300005615 Bacteria 3432
37 Ga0068852_100008316 3300005616 Bacteria 7636
38 Ga0068866_10052086 3300005718 Bacteria 2087
39 Ga0068866_10109049 3300005718 Bacteria 1541
40 Ga0068870_10000762 3300005840 Bacteria 12392
41 Ga0068858_100020957 3300005842 Bacteria 6107
42 Ga0081455_10010650 3300005937 Bacteria 9303
43 Ga0081538_10000040 3300005981 Bacteria 118224
44 Ga0081538_10000048 3300005981 Bacteria 111909
45 Ga0081538_10000127 3300005981 Bacteria 77655
46 Ga0081538_10001381 3300005981 Bacteria 24913
47 Ga0081538_10001637 3300005981 Bacteria 22971
48 Ga0081538_10001805 3300005981 Bacteria 21584
49 Ga0081538_10002875 3300005981 Bacteria 16446
50 Ga0081538_10003079 3300005981 Bacteria 15857
51 Ga0081538_10003939 3300005981 Bacteria 13847
52 Ga0081538_10004391 3300005981 Bacteria 13021
53 Ga0081538_10005466 3300005981 Bacteria 11414
54 Ga0081538_10005774 3300005981 Bacteria 11042
55 Ga0081538_10006327 3300005981 Bacteria 10452
56 Ga0081538_10009336 3300005981 Bacteria 8201
57 Ga0081538_10009411 3300005981 Bacteria 8163
58 Ga0081538_10014476 3300005981 Bacteria 6175
59 Ga0081538_10014736 3300005981 Bacteria 6100
60 Ga0081538_10016874 3300005981 Bacteria 5571
61 Ga0081538_10017565 3300005981 Bacteria 5422
62 Ga0081538_10017619 3300005981 Bacteria 5411
63 Ga0081538_10018519 3300005981 Bacteria 5225
64 Ga0081538_10023352 3300005981 Bacteria 4448
65 Ga0081538_10042363 3300005981 Bacteria 2874
66 Ga0081538_10056681 3300005981 Bacteria 2292
67 Ga0081538_10059194 3300005981 Bacteria 2214
68 Ga0081538_10061770 3300005981 Bacteria 2142
69 Ga0081538_10123331 3300005981 Bacteria 1239
70 Ga0070712_100291212 3300006175 Bacteria 1318
71 Ga0097621_100231331 3300006237 Bacteria 1614
72 Ga0068871_100032485 3300006358 Bacteria 4124
73 Ga0075428_100232661 3300006844 Bacteria 1989
74 Ga0075428_100523917 3300006844 Bacteria 1268
75 Ga0075430_100000211 3300006846 Bacteria 39886
76 Ga0075433_10000119 3300006852 Bacteria 39528
77 Ga0075433_10008700 3300006852 Bacteria 8100
78 Ga0075433_10190091 3300006852 Bacteria 1827
79 Ga0075434_100000835 3300006871 Bacteria 24504
80 Ga0075434_100002284 3300006871 Bacteria 16769
81 Ga0075434_100026751 3300006871 Bacteria 5656
82 Ga0075434_100696106 3300006871 Bacteria 1034
83 Ga0075429_100047967 3300006880 Bacteria 3715
84 Ga0068865_100086108 3300006881 Bacteria 2268
85 Ga0111539_10206509 3300009094 Bacteria 2289
86 Ga0111539_10338406 3300009094 Bacteria 1752
87 Ga0105245_10006191 3300009098 Bacteria 10531
88 Ga0105245_10047720 3300009098 Bacteria 3829
89 Ga0105245_10059853 3300009098 Bacteria 3430
90 Ga0114129_10029720 3300009147 Bacteria 7738
91 Ga0114129_10105859 3300009147 Bacteria 3886
92 Ga0114129_10443222 3300009147 Bacteria 1704
93 Ga0114129_10674939 3300009147 Bacteria 1331
94 Ga0114129_10844563 3300009147 Bacteria 1165
95 Ga0105241_10028125 3300009174 Bacteria 4187
96 Ga0105242_10068368 3300009176 Bacteria 2939
97 Ga0105242_10451005 3300009176 Bacteria 1212
98 Ga0105242_10704030 3300009176 Bacteria 989
99 Ga0105248_10467355 3300009177 Bacteria 1422
100 Ga0105238_10044492 3300009551 Bacteria 4487
101 Ga0105249_10453157 3300009553 Bacteria 1322
102 Ga0105239_10185932 3300010375 Bacteria 2325
103 Ga0105246_10077968 3300011119 Bacteria 2352
104 Ga0105246_10167453 3300011119 Bacteria 1680
105 Ga0157378_10133297 3300013297 Bacteria 2302
106 Ga0157378_10477982 3300013297 Bacteria 1241
107 Ga0163162_10024770 3300013306 Bacteria 5927
108 Ga0163162_10046790 3300013306 Bacteria 4336
109 Ga0157372_10225692 3300013307 Bacteria 2171
110 Ga0157375_10041360 3300013308 Bacteria 4450
111 Ga0157375_10486698 3300013308 Unclassified 1399
112 Ga0163163_10092096 3300014325 Bacteria 3046
113 Ga0157377_10006037 3300014745 Bacteria 5746
114 Ga0157376_10067892 3300014969 Bacteria 3017
115 Ga0157376_10130510 3300014969 Bacteria 2241
116 Ga0213871_10010049 3300021441 Bacteria 2137
117 Ga0207643_10023742 3300025908 Bacteria 3382
118 Ga0207654_10079385 3300025911 Bacteria 1971
119 Ga0207662_10074345 3300025918 Bacteria 2063
120 Ga0207652_10155832 3300025921 Bacteria 2046
121 Ga0207650_10008780 3300025925 Bacteria 6907
122 Ga0207659_10100639 3300025926 Bacteria 2178
123 Ga0207687_10001247 3300025927 Bacteria 17414
124 Ga0207690_10593243 3300025932 Bacteria 904
125 Ga0207706_10004007 3300025933 Bacteria 13942
126 Ga0207686_10098026 3300025934 Bacteria 1951
127 Ga0207689_10049073 3300025942 Bacteria 3483
128 Ga0207661_10219017 3300025944 Bacteria 1681
129 Ga0207667_10532521 3300025949 Bacteria 1189
130 Ga0207712_10004247 3300025961 Bacteria 9039
131 Ga0207668_10012853 3300025972 Bacteria 5137
132 Ga0207677_10084830 3300026023 Bacteria 2284
133 Ga0207703_10040491 3300026035 Bacteria 3729
134 Ga0207639_10106246 3300026041 Bacteria 2278
135 Ga0207708_10002912 3300026075 Bacteria 12612
136 Ga0207708_10109868 3300026075 Bacteria 2139
137 Ga0207702_10247886 3300026078 Bacteria 1671
138 Ga0207648_10095467 3300026089 Bacteria 2601
139 Ga0207674_10092231 3300026116 Bacteria 3018
140 Ga0207675_100006208 3300026118 Bacteria 11346
141 Ga0207683_10093882 3300026121 Bacteria 2674
142 Ga0207683_10223228 3300026121 Bacteria 1717
143 Ga0207428_10303810 3300027907 Bacteria 1181
144 Ga0307408_100301551 3300031548 Bacteria 1342
145 Ga0307405_10031524 3300031731 Bacteria 3122
146 Ga0307413_10068661 3300031824 Unclassified 2221
147 Ga0307413_10268957 3300031824 Bacteria 1275
148 Ga0307409_100164936 3300031995 Bacteria 1943
149 Ga0307409_100239660 3300031995 Bacteria 1650
150 Ga0307416_100000621 3300032002 Bacteria 18291
151 Ga0307416_100033356 3300032002 Bacteria 3902
152 Ga0307416_100038432 3300032002 Bacteria 3693
153 Ga0307416_100051862 3300032002 Bacteria 3280
154 Ga0307411_10493979 3300032005 Unclassified 1033
155 Ga0307415_100000438 3300032126 Bacteria 17886
156 Ga0307415_100006213 3300032126 Bacteria 6418
157 Ga0307415_100078654 3300032126 Bacteria 2347
158 Ga0373926_0043460 3300035083 Bacteria 1608
159 Ga0373962_0040441 3300035242 Bacteria 1311
160 Ga0373931_0353413 3300035691 Bacteria 920
161 Ga0373925_0006358 3300037068 Bacteria 8695
162 Ga0395900_0015123 3300037418 Bacteria 7868
163 Ga0395900_0111606 3300037418 Bacteria 2808
164 Ga0395898_0405257 3300037466 Bacteria 1300
165 Ga0395898_0501905 3300037466 Bacteria 1154
166 Ga0395905_0197300 3300037471 Bacteria 1887
167 Ga0395901_0145902 3300038443 Bacteria 2487
168 Ga0395901_0592853 3300038443 Bacteria 1118
169 Ga0436360_0216318 3300039438 Bacteria 2837
170 Ga0451837_0084324 3300041494 Bacteria 1169
171 Ga0466960_0358665 3300044901 Bacteria 833
172 Ga0495629_0236667 3300046459 Bacteria 1258
173 Ga0495582_0178606 3300046473 Bacteria 1209
174 Ga0495665_0005243 3300046531 Bacteria 6985
175 Ga0495622_0209816 3300046557 Bacteria 866
176 Ga0495647_0058360 3300046681 Bacteria 1517
177 Ga0496106_0521924 3300048909 Bacteria 954
178 Ga0496108_0290233 3300048911 Bacteria 1424
179 Ga0496109_0103017 3300048912 Bacteria 2649
180 Ga0496109_0271273 3300048912 Bacteria 1598
181 Ga0496110_0295045 3300048913 Bacteria 1477
182 Ga0496114_0110568 3300048917 Bacteria 2354
183 Ga0501032_0236804 3300049569 Unclassified 1186
184 Ga0501033_0022243 3300049570 Bacteria 4784
185 Ga0501036_0002956 3300049572 Bacteria 13506
186 Ga0501037_0117149 3300049573 Unclassified 1917
187 Ga0501038_0016556 3300049574 Bacteria 6683
188 Ga0501040_0005788 3300049576 Bacteria 8000
189 Ga0501042_0000705 3300049578 Bacteria 18109
190 Ga0501048_0156594 3300049582 Unclassified 1611
191 Ga0501067_0001464 3300049583 Bacteria 12831
192 Ga0501067_0015522 3300049583 Bacteria 4216
193 Ga0501068_0011571 3300049584 Bacteria 4983
194 Ga0501069_0010481 3300049585 Bacteria 4907
195 Ga0501070_0011433 3300049586 Bacteria 7499
196 Ga0501070_0099476 3300049586 Bacteria 2406
197 Ga0501071_0146030 3300049587 Bacteria 1763
198 Ga0501073_0011510 3300049589 Bacteria 6469
199 Ga0501074_0003699 3300049590 Bacteria 10843
200 Ga0501075_0017289 3300049591 Bacteria 5208
201 Ga0501080_0001672 3300049742 Bacteria 18888
202 Ga0501081_0078062 3300049743 Bacteria 2314
203 Ga0501083_0015208 3300049744 Bacteria 5388
204 nmdc:mga05p37_20105_c1 3300050507 Bacteria 8080
205 nmdc:mga05p37_309778_c1 3300050507 Bacteria 1872
206 nmdc:mga05p37_488131_c1 3300050507 Bacteria 1417
207 nmdc:mga09592_153539_c1 3300050508 Bacteria 1987
208 nmdc:mga0qj67_44776_c1 3300050509 Bacteria 3490
209 nmdc:mga06r32_174496_c1 3300050510 Bacteria 2134
210 nmdc:mga08y16_258633_c1 3300050511 Bacteria 1798
211 nmdc:mga08y16_33295_c1 3300050511 Bacteria 5412
212 nmdc:mga0n895_12642_c1 3300050512 Bacteria 7578
213 nmdc:mga0n895_13879_c1 3300050512 Bacteria 7294
214 nmdc:mga0a205_325_c1 3300050515 Bacteria 35736
215 nmdc:mga0a205_41697_c1 3300050515 Bacteria 4421
216 nmdc:mga0a205_71458_c1 3300050515 Bacteria 3351
217 Ga0495619_0255810 3300053085 Bacteria 1213
218 Ga0501084_0019136 3300054114 Bacteria 5703
219 Ga0501082_0009340 3300060353 Bacteria 8452
220 Ga0530510_0001506 3300061734 Bacteria 15662
221 Ga0530510_0107038 3300061734 Bacteria 2046
222 JGI25407J50210_10005617
223 JGI25407J50210_10002364
224 JGI25407J50210_10006529
225 JGI25407J50210_10007148
226 JGI25407J50210_10024814
227 Ga0070670_100013991
228 Ga0068869_100239964
229 Ga0070682_100046462
230 Ga0070687_100036425
231 Ga0070661_100067111
232 Ga0070668_100028661
233 Ga0070675_100064784
234 Ga0070673_100059346
235 Ga0070688_100028966
236 Ga0070659_100022555
237 Ga0070659_100384233
238 Ga0070713_100207085
239 Ga0070705_100080946
240 Ga0070700_100033588
241 Ga0070700_100359966
242 Ga0070708_100006313
243 Ga0070708_100022480
244 Ga0070678_100125156
245 Ga0068867_100134620
246 Ga0070685_10008905
247 Ga0070686_100001762
248 Ga0070696_100217992
249 Ga0070704_100084655
250 Ga0070704_100164708
251 Ga0068855_100218489
252 Ga0070664_100018940
253 Ga0070664_100270999
254 Ga0068857_100067098
255 Ga0068857_100072830
256 Ga0068856_100091328
257 Ga0070702_100020966
258 Ga0068852_100008316
259 Ga0068866_10052086
260 Ga0068866_10109049
261 Ga0068870_10000762
262 Ga0068858_100020957
263 Ga0081455_10010650
264 Ga0081538_10000040
265 Ga0081538_10000048
266 Ga0081538_10000127
267 Ga0081538_10001381
268 Ga0081538_10001637
269 Ga0081538_10001805
270 Ga0081538_10002875
271 Ga0081538_10003079
272 Ga0081538_10003939
273 Ga0081538_10004391
274 Ga0081538_10005466
275 Ga0081538_10005774
276 Ga0081538_10006327
277 Ga0081538_10009336
278 Ga0081538_10009411
279 Ga0081538_10014476
280 Ga0081538_10014736
281 Ga0081538_10016874
282 Ga0081538_10017565
283 Ga0081538_10017619
284 Ga0081538_10018519
285 Ga0081538_10023352
286 Ga0081538_10042363
287 Ga0081538_10056681
288 Ga0081538_10059194
289 Ga0081538_10061770
290 Ga0081538_10123331
291 Ga0070712_100291212
292 Ga0097621_100231331
293 Ga0068871_100032485
294 Ga0075428_100232661
295 Ga0075428_100523917
296 Ga0075430_100000211
297 Ga0075433_10000119
298 Ga0075433_10008700
299 Ga0075433_10190091
300 Ga0075434_100000835
301 Ga0075434_100002284
302 Ga0075434_100026751
303 Ga0075434_100696106
304 Ga0075429_100047967
305 Ga0068865_100086108
306 Ga0111539_10206509
307 Ga0111539_10338406
308 Ga0105245_10006191
309 Ga0105245_10047720
310 Ga0105245_10059853
311 Ga0114129_10029720
312 Ga0114129_10105859
313 Ga0114129_10443222
314 Ga0114129_10674939
315 Ga0114129_10844563
316 Ga0105241_10028125
317 Ga0105242_10068368
318 Ga0105242_10451005
319 Ga0105242_10704030
320 Ga0105248_10467355
321 Ga0105238_10044492
322 Ga0105249_10453157
323 Ga0105239_10185932
324 Ga0105246_10077968
325 Ga0105246_10167453
326 Ga0157378_10133297
327 Ga0157378_10477982
328 Ga0163162_10024770
329 Ga0163162_10046790
330 Ga0157372_10225692
331 Ga0157375_10041360
332 Ga0157375_10486698
333 Ga0163163_10092096
334 Ga0157377_10006037
335 Ga0157376_10067892
336 Ga0157376_10130510
337 Ga0213871_10010049
338 Ga0207643_10023742
339 Ga0207654_10079385
340 Ga0207662_10074345
341 Ga0207652_10155832
342 Ga0207650_10008780
343 Ga0207659_10100639
344 Ga0207687_10001247
345 Ga0207690_10593243
346 Ga0207706_10004007
347 Ga0207686_10098026
348 Ga0207689_10049073
349 Ga0207661_10219017
350 Ga0207667_10532521
351 Ga0207712_10004247
352 Ga0207668_10012853
353 Ga0207677_10084830
354 Ga0207703_10040491
355 Ga0207639_10106246
356 Ga0207708_10002912
357 Ga0207708_10109868
358 Ga0207702_10247886
359 Ga0207648_10095467
360 Ga0207674_10092231
361 Ga0207675_100006208
362 Ga0207683_10093882
363 Ga0207683_10223228
364 Ga0207428_10303810
365 Ga0307408_100301551
366 Ga0307405_10031524
367 Ga0307413_10068661
368 Ga0307413_10268957
369 Ga0307409_100164936
370 Ga0307409_100239660
371 Ga0307416_100000621
372 Ga0307416_100033356
373 Ga0307416_100038432
374 Ga0307416_100051862
375 Ga0307411_10493979
376 Ga0307415_100000438
377 Ga0307415_100006213
378 Ga0307415_100078654
379 Ga0373926_0043460
380 Ga0373962_0040441
381 Ga0373931_0353413
382 Ga0373925_0006358
383 Ga0395900_0015123
384 Ga0395900_0111606
385 Ga0395898_0405257
386 Ga0395898_0501905
387 Ga0395905_0197300
388 Ga0395901_0145902
389 Ga0395901_0592853
390 Ga0436360_0216318
391 Ga0451837_0084324
392 Ga0466960_0358665
393 Ga0495629_0236667
394 Ga0495582_0178606
395 Ga0495665_0005243
396 Ga0495622_0209816
397 Ga0495647_0058360
398 Ga0496106_0521924
399 Ga0496108_0290233
400 Ga0496109_0103017
401 Ga0496109_0271273
402 Ga0496110_0295045
403 Ga0496114_0110568
404 Ga0501032_0236804
405 Ga0501033_0022243
406 Ga0501036_0002956
407 Ga0501037_0117149
408 Ga0501038_0016556
409 Ga0501040_0005788
410 Ga0501042_0000705
411 Ga0501048_0156594
412 Ga0501067_0001464
413 Ga0501067_0015522
414 Ga0501068_0011571
415 Ga0501069_0010481
416 Ga0501070_0011433
417 Ga0501070_0099476
418 Ga0501071_0146030
419 Ga0501073_0011510
420 Ga0501074_0003699
421 Ga0501075_0017289
422 Ga0501080_0001672
423 Ga0501081_0078062
424 Ga0501083_0015208
425 nmdc:mga05p37_20105_c1
426 nmdc:mga05p37_309778_c1
427 nmdc:mga05p37_488131_c1
428 nmdc:mga09592_153539_c1
429 nmdc:mga0qj67_44776_c1
430 nmdc:mga06r32_174496_c1
431 nmdc:mga08y16_258633_c1
432 nmdc:mga08y16_33295_c1
433 nmdc:mga0n895_12642_c1
434 nmdc:mga0n895_13879_c1
435 nmdc:mga0a205_325_c1
436 nmdc:mga0a205_41697_c1
437 nmdc:mga0a205_71458_c1
438 Ga0495619_0255810
439 Ga0501084_0019136
440 Ga0501082_0009340
441 Ga0530510_0001506
442 Ga0530510_0107038

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09948

DUF2182

Predicted metal-binding integral membrane protein (DUF2182)

90

277

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dg6-assembly5.cif.gz_E structure of a de novo designed interleukin-2/interleukin-15 mimetic 0.4201 140 255
6dg6-assembly5.cif.gz_E structure of a de novo designed interleukin-2/interleukin-15 mimetic 0.4065 140 255
7jz2-assembly1.cif.gz_C succinate: quinone oxidoreductase sqr from e.coli k12 0.3076 149 258
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.2995 27 254
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.299 63 254
ID Description Score Start End Superfamily
af_P07018_22_188_1.20.120.30 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Aspartate receptor, ligand-binding domain 0.3932 121 264 1.20.120.30
af_Q54EX8_76_272_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3859 61 260 1.20.1250.20
af_A0A0P0VB13_1_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3681 116 265 1.20.1250.20
af_Q2G0K4_242_431_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3647 112 260 1.20.1250.20
af_P07018_22_188_1.20.120.30 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Aspartate receptor, ligand-binding domain 0.3551 121 264 1.20.120.30
ID Description Score Start End GO Terms
AF-A0A535EYR7-F1-model_v4 DUF2182 domain-containing protein 0.9391 80 260 GO:0016020
AF-A0A2E5IT01-F1-model_v4 DUF2182 domain-containing protein 0.9313 55 263 GO:0016020
AF-A0A2A5FEL2-F1-model_v4 DUF2182 domain-containing protein 0.9294 33 254 GO:0016020
AF-A0A7C1FVK4-F1-model_v4 DUF2182 domain-containing protein 0.9268 33 254 GO:0016020
AF-A0A7W0TXF3-F1-model_v4 DUF2182 domain-containing protein 0.9246 63 257 GO:0016020

Map