F332786

General Info

Members Datasets Scaffolds Average Seq Length
220 166 441 121

Family's Representative Sequence

Representative Sequence 3300053139|Ga0500568_0112565|Ga0500568_0112565_264_683
Length 139
Sequence MHIYRYLRVSKQFFMRIIKLVMVMLLAAVGTATMAQSKKGTLVTAKISTPTVQCEQCKDRIEKYMLQEEGIASTKVDVKKHITTVKFFTDRTNIENVKTAIANAGYDADNVTANPETYAKLPTCCKKPEDGGGHPDKKH

Samples

Sample ID Description Type Environment
1 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
95 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
108 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
109 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
110 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
111 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
117 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
118 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
119 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
120 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
121 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
122 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
123 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
124 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
125 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
126 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
127 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
128 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
129 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
130 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
131 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
132 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
133 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
134 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
135 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
136 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
137 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
138 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
139 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
140 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
141 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
142 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
143 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
144 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
148 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
149 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
150 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
154 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
155 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
156 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
157 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
158 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
159 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
160 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
161 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
162 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
163 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
164 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
165 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
166 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.73
Metatranscriptomes 1.36
Isolates 5.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.18
Nodule 0
Rhizoplane 0
Rhizosphere 72.27
Stem 0
Stem Tuber 0
Unclassified 17.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500568_0112565 3300053139 Bacteria 1016
2 JGI24740J21852_10000721 3300001979 Bacteria 14384
3 JGI24739J22299_10030862 3300001989 Bacteria 1855
4 JGI24739J22299_10069848 3300001989 Bacteria 1094
5 JGI25154J39366_1000022 3300002738 Bacteria 219590
6 JGI25153J46596_10001856 3300003215 Bacteria 12524
7 JGI25153J46596_10029644 3300003215 Bacteria 1874
8 rootH2_10086802 3300003320 Bacteria 3310
9 rootL2_10131534 3300003322 Bacteria 4650
10 rootH1_10043452 3300003316 Bacteria 20626
11 rootH1_10043452 3300003323 Bacteria 4798
12 JGI25160J50197_1005230 3300003354 Bacteria 5441
13 JGI25160J50197_1013451 3300003354 Unclassified 2789
14 Ga0055526_1012877 3300003771 Bacteria 3596
15 Ga0055528_1000770 3300003790 Bacteria 22396
16 Ga0055530_10001595 3300003791 Bacteria 16237
17 Ga0055531_10000101 3300003794 Bacteria 93150
18 Ga0055543_1010955 3300004625 Bacteria 1878
19 Ga0065165_1000009 3300005262 Bacteria 327432
20 Ga0065165_1025245 3300005262 Bacteria 1980
21 Ga0070658_10137987 3300005327 Bacteria 2036
22 Ga0070676_10109349 3300005328 Unclassified 1719
23 Ga0070670_100097616 3300005331 Bacteria 2528
24 Ga0070670_100539339 3300005331 Bacteria 1040
25 Ga0070670_101136844 3300005331 Bacteria 713
26 Ga0070680_100001133 3300005336 Bacteria 19138
27 Ga0070682_100000460 3300005337 Bacteria 25673
28 Ga0070660_100261228 3300005339 Bacteria 1414
29 Ga0070691_10005977 3300005341 Bacteria 5555
30 Ga0070671_100828319 3300005355 Unclassified 806
31 Ga0070667_100126081 3300005367 Bacteria 2231
32 Ga0070667_101403512 3300005367 Bacteria 655
33 Ga0070710_10316431 3300005437 Bacteria 1023
34 Ga0070678_100018020 3300005456 Bacteria 4566
35 Ga0070678_100500063 3300005456 Bacteria 1072
36 Ga0070681_10003852 3300005458 Bacteria 14114
37 Ga0070679_100018384 3300005530 Bacteria 6782
38 Ga0068853_100001289 3300005539 Bacteria 17984
39 Ga0068853_100109982 3300005539 Bacteria 2447
40 Ga0068853_100151716 3300005539 Bacteria 2086
41 Ga0068853_102296703 3300005539 Bacteria 523
42 Ga0070672_100065133 3300005543 Bacteria 2881
43 Ga0070672_100774830 3300005543 Unclassified 843
44 Ga0070672_101230649 3300005543 Bacteria 667
45 Ga0070693_100034169 3300005547 Bacteria 2812
46 Ga0068855_100090726 3300005563 Bacteria 3526
47 Ga0068855_100853344 3300005563 Bacteria 965
48 Ga0068854_100702447 3300005578 Bacteria 873
49 Ga0068866_10716549 3300005718 Bacteria 688
50 Ga0068861_100419204 3300005719 Bacteria 1192
51 Ga0075366_10022561 3300006195 Bacteria 3663
52 Ga0097621_100023427 3300006237 Bacteria 4809
53 Ga0075370_10124906 3300006353 Bacteria 1500
54 Ga0068871_100002202 3300006358 Bacteria 13246
55 Ga0105240_10084279 3300009093 Bacteria 3898
56 Ga0105241_10000113 3300009174 Bacteria 58135
57 Ga0105241_10186644 3300009174 Bacteria 1724
58 Ga0105241_11406528 3300009174 Unclassified 668
59 Ga0105237_10356746 3300009545 Bacteria 1466
60 Ga0105237_10448369 3300009545 Bacteria 1296
61 Ga0105237_11047823 3300009545 Unclassified 822
62 Ga0105239_10021879 3300010375 Bacteria 7050
63 Ga0157373_10907940 3300013100 Bacteria 654
64 Ga0157373_11083618 3300013100 Bacteria 600
65 Ga0157371_10133226 3300013102 Bacteria 1768
66 Ga0157371_10156254 3300013102 Unclassified 1628
67 Ga0157371_10767619 3300013102 Bacteria 725
68 Ga0157370_10001056 3300013104 Bacteria 34670
69 Ga0157370_10542527 3300013104 Bacteria 1066
70 Ga0157374_10226954 3300013296 Bacteria 1834
71 Ga0163162_10093304 3300013306 Bacteria 3095
72 Ga0163162_10172884 3300013306 Bacteria 2285
73 Ga0163162_10548343 3300013306 Bacteria 1285
74 Ga0157375_12427584 3300013308 Bacteria 626
75 Ga0157375_13223331 3300013308 Bacteria 544
76 Ga0157379_10460008 3300014968 Bacteria 1176
77 Ga0157376_10306370 3300014969 Unclassified 1505
78 Ga0157376_10355379 3300014969 Unclassified 1403
79 Ga0157376_10752229 3300014969 Bacteria 984
80 Ga0157376_11841006 3300014969 Bacteria 642
81 Ga0182005_1000056 3300015265 Bacteria 108603
82 Ga0163161_10330700 3300017792 Bacteria 1207
83 Ga0163161_10884651 3300017792 Unclassified 756
84 Ga0209436_100576 3300025208 Bacteria 15731
85 Ga0209436_101169 3300025208 Bacteria 9671
86 Ga0209646_1000003 3300025246 Bacteria 1160860
87 Ga0209026_1000354 3300025250 Bacteria 43355
88 Ga0209129_1060240 3300025258 Unclassified 563
89 Ga0209673_1000103 3300025273 Bacteria 188104
90 Ga0209130_1000538 3300025284 Bacteria 38127
91 Ga0209675_1043056 3300025291 Bacteria 974
92 Ga0209564_1007298 3300025295 Bacteria 5736
93 Ga0209758_1007585 3300025297 Bacteria 7329
94 Ga0209758_1015665 3300025297 Bacteria 3908
95 Ga0209050_1000902 3300025298 Bacteria 39295
96 Ga0207426_1000034 3300025302 Bacteria 454016
97 Ga0207426_1000187 3300025302 Bacteria 153809
98 Ga0207426_1000943 3300025302 Bacteria 28824
99 Ga0207426_1015358 3300025302 Bacteria 2778
100 Ga0209051_1029365 3300025303 Bacteria 2153
101 Ga0209257_1000025 3300025304 Bacteria 724838
102 Ga0209257_1008721 3300025304 Bacteria 5653
103 Ga0207682_10491529 3300025893 Bacteria 581
104 Ga0207692_10466979 3300025898 Bacteria 797
105 Ga0207643_10437385 3300025908 Bacteria 831
106 Ga0207705_10200073 3300025909 Bacteria 1513
107 Ga0207654_10000461 3300025911 Bacteria 23222
108 Ga0207654_10723970 3300025911 Bacteria 716
109 Ga0207707_10000189 3300025912 Bacteria 65118
110 Ga0207695_10005484 3300025913 Bacteria 16803
111 Ga0207671_10456174 3300025914 Bacteria 1018
112 Ga0207671_10503535 3300025914 Unclassified 965
113 Ga0207660_10021105 3300025917 Unclassified 4377
114 Ga0207652_10000488 3300025921 Bacteria 40566
115 Ga0207650_10343393 3300025925 Bacteria 1226
116 Ga0207650_10427537 3300025925 Bacteria 1100
117 Ga0207650_10565359 3300025925 Bacteria 954
118 Ga0207659_10173913 3300025926 Bacteria 1701
119 Ga0207667_10110361 3300025949 Bacteria 2837
120 Ga0207668_11293827 3300025972 Unclassified 656
121 Ga0207658_10112902 3300025986 Bacteria 2152
122 Ga0207658_10509713 3300025986 Unclassified 1073
123 Ga0207639_10012101 3300026041 Bacteria 6003
124 Ga0207639_10089332 3300026041 Bacteria 2462
125 Ga0207639_10538046 3300026041 Bacteria 1071
126 Ga0207639_11142231 3300026041 Bacteria 731
127 Ga0207641_12639301 3300026088 Bacteria 500
128 Ga0207648_10081468 3300026089 Unclassified 2823
129 Ga0207674_11485930 3300026116 Unclassified 647
130 Ga0207683_10082258 3300026121 Bacteria 2860
131 Ga0307515_10000251 3300028794 Bacteria 132970
132 Ga0307515_10166276 3300028794 Bacteria 2222
133 Ga0307508_10001604 3300031616 Bacteria 25228
134 Ga0307413_10293837 3300031824 Bacteria 1229
135 Ga0307413_10806975 3300031824 Bacteria 789
136 Ga0307412_10385019 3300031911 Bacteria 1137
137 Ga0307414_10274825 3300032004 Bacteria 1413
138 Ga0307414_11172591 3300032004 Unclassified 711
139 Ga0307414_11828295 3300032004 Bacteria 567
140 Ga0439436_0044412 3300041404 Bacteria 1266
141 Ga0451853_0402783 3300041512 Unclassified 672
142 Ga0439431_0001683 3300041997 Bacteria 4881
143 Ga0439431_0221161 3300041997 Bacteria 556
144 Ga0439457_063679 3300042014 Bacteria 837
145 Ga0451577_0021778 3300042876 Bacteria 5861
146 Ga0453684_1408821 3300044712 Unclassified 722
147 Ga0466960_0112596 3300044901 Unclassified 1416
148 Ga0466959_0042368 3300045049 Bacteria 3358
149 Ga0451576_0696238 3300045051 Bacteria 1068
150 Ga0495625_0028672 3300046660 Bacteria 4172
151 Ga0495600_0195258 3300046809 Bacteria 1301
152 Ga0495672_0095000 3300047320 Bacteria 1629
153 Ga0496121_0000028 3300048924 Bacteria 439193
154 Ga0496126_0037459 3300048929 Bacteria 4525
155 Ga0501307_071763 3300049162 Unclassified 553
156 Ga0501292_015313 3300049515 Unclassified 1198
157 Ga0501296_004227 3300049519 Bacteria 1560
158 Ga0501298_011166 3300049521 Unclassified 1556
159 Ga0501300_020076 3300049523 Bacteria 975
160 Ga0501332_19474 3300049548 Unclassified 501
161 Ga0501336_008234 3300049552 Unclassified 804
162 Ga0501033_0073028 3300049570 Bacteria 2519
163 Ga0501034_0170724 3300049571 Bacteria 2142
164 Ga0501047_0009758 3300049581 Bacteria 9071
165 Ga0501199_030020 3300049650 Unclassified 667
166 Ga0501201_009248 3300049651 Bacteria 957
167 Ga0501202_001001 3300049652 Bacteria 4371
168 Ga0501202_157518 3300049652 Bacteria 599
169 Ga0501206_002723 3300049653 Bacteria 2225
170 Ga0501207_009883 3300049654 Bacteria 1400
171 Ga0501208_015250 3300049655 Bacteria 1177
172 Ga0501209_108818 3300049656 Bacteria 817
173 Ga0501217_001447 3300049661 Bacteria 4450
174 Ga0501223_023596 3300049663 Unclassified 1199
175 Ga0501227_071153 3300049665 Unclassified 903
176 Ga0501233_055454 3300049668 Bacteria 970
177 Ga0501235_001131 3300049669 Bacteria 5594
178 Ga0501235_022449 3300049669 Unclassified 1403
179 Ga0501238_013477 3300049671 Bacteria 1114
180 Ga0501238_025832 3300049671 Unclassified 842
181 Ga0501240_001076 3300049673 Bacteria 2539
182 Ga0501242_024939 3300049674 Bacteria 785
183 Ga0501243_000076 3300049675 Bacteria 9930
184 Ga0501252_000646 3300049682 Bacteria 2801
185 Ga0501253_123165 3300049683 Bacteria 630
186 Ga0501257_038208 3300049686 Unclassified 1173
187 Ga0501259_010551 3300049688 Bacteria 1511
188 Ga0501261_000749 3300049690 Bacteria 4039
189 Ga0501221_000930 3300049704 Bacteria 4798
190 Ga0501225_0046375 3300049705 Bacteria 1205
191 Ga0501229_016269 3300049706 Unclassified 967
192 Ga0501234_012189 3300049707 Bacteria 1346
193 Ga0501245_002536 3300049708 Bacteria 2442
194 Ga0501245_030734 3300049708 Unclassified 887
195 Ga0501241_024527 3300049758 Bacteria 1120
196 Ga0501241_122915 3300049758 Unclassified 578
197 Ga0501283_069707 3300049779 Unclassified 646
198 Ga0501212_015296 3300049851 Bacteria 1143
199 Ga0501212_031603 3300049851 Bacteria 855
200 nmdc:mga07m45_539004_c1 3300050496 Bacteria 675
201 Ga0500646_0086232 3300053090 Bacteria 965
202 Ga0500562_022481 3300053108 Unclassified 1644
203 Ga0500594_0075827 3300053118 Bacteria 997
204 Ga0500652_002787 3300053131 Bacteria 5278
205 Ga0500604_0050300 3300053151 Bacteria 1284
206 Ga0500616_0279239 3300053153 Unclassified 702
207 Ga0500622_0001037 3300053156 Bacteria 23205
208 Ga0500645_016518 3300053730 Bacteria 2324
209 2819572851 2818991442 Bacteria 8318214
210 2821139735 2821136567 Bacteria 8080116
211 2883069302 2883068021 Bacteria 6192739
212 2884794867 2884791551 Bacteria 8511252
213 2896088205 2896085136 Bacteria 6129793
214 2896112058 2896109856 Bacteria 7140722
215 2904473513 2904467357 Bacteria 8057758
216 2929179495 2929177148 Bacteria 7883697
217 2929244638 2929239360 Bacteria 7745570
218 2929926768 2929921140 Bacteria 8649150
219 2945981905 2945977869 Bacteria 7777518
220 2946018696 2946013367 Bacteria 7766675
221 8003156237 8003151029 Bacteria 8187759
222 Ga0500568_0112565
223 JGI24740J21852_10000721
224 JGI24739J22299_10030862
225 JGI24739J22299_10069848
226 JGI25154J39366_1000022
227 JGI25153J46596_10001856
228 JGI25153J46596_10029644
229 rootH2_10086802
230 rootL2_10131534
231 rootH1_10043452
232 JGI25160J50197_1005230
233 JGI25160J50197_1013451
234 Ga0055526_1012877
235 Ga0055528_1000770
236 Ga0055530_10001595
237 Ga0055531_10000101
238 Ga0055543_1010955
239 Ga0065165_1000009
240 Ga0065165_1025245
241 Ga0070658_10137987
242 Ga0070676_10109349
243 Ga0070670_100097616
244 Ga0070670_100539339
245 Ga0070670_101136844
246 Ga0070680_100001133
247 Ga0070682_100000460
248 Ga0070660_100261228
249 Ga0070691_10005977
250 Ga0070671_100828319
251 Ga0070667_100126081
252 Ga0070667_101403512
253 Ga0070710_10316431
254 Ga0070678_100018020
255 Ga0070678_100500063
256 Ga0070681_10003852
257 Ga0070679_100018384
258 Ga0068853_100001289
259 Ga0068853_100109982
260 Ga0068853_100151716
261 Ga0068853_102296703
262 Ga0070672_100065133
263 Ga0070672_100774830
264 Ga0070672_101230649
265 Ga0070693_100034169
266 Ga0068855_100090726
267 Ga0068855_100853344
268 Ga0068854_100702447
269 Ga0068866_10716549
270 Ga0068861_100419204
271 Ga0075366_10022561
272 Ga0097621_100023427
273 Ga0075370_10124906
274 Ga0068871_100002202
275 Ga0105240_10084279
276 Ga0105241_10000113
277 Ga0105241_10186644
278 Ga0105241_11406528
279 Ga0105237_10356746
280 Ga0105237_10448369
281 Ga0105237_11047823
282 Ga0105239_10021879
283 Ga0157373_10907940
284 Ga0157373_11083618
285 Ga0157371_10133226
286 Ga0157371_10156254
287 Ga0157371_10767619
288 Ga0157370_10001056
289 Ga0157370_10542527
290 Ga0157374_10226954
291 Ga0163162_10093304
292 Ga0163162_10172884
293 Ga0163162_10548343
294 Ga0157375_12427584
295 Ga0157375_13223331
296 Ga0157379_10460008
297 Ga0157376_10306370
298 Ga0157376_10355379
299 Ga0157376_10752229
300 Ga0157376_11841006
301 Ga0182005_1000056
302 Ga0163161_10330700
303 Ga0163161_10884651
304 Ga0209436_100576
305 Ga0209436_101169
306 Ga0209646_1000003
307 Ga0209026_1000354
308 Ga0209129_1060240
309 Ga0209673_1000103
310 Ga0209130_1000538
311 Ga0209675_1043056
312 Ga0209564_1007298
313 Ga0209758_1007585
314 Ga0209758_1015665
315 Ga0209050_1000902
316 Ga0207426_1000034
317 Ga0207426_1000187
318 Ga0207426_1000943
319 Ga0207426_1015358
320 Ga0209051_1029365
321 Ga0209257_1000025
322 Ga0209257_1008721
323 Ga0207682_10491529
324 Ga0207692_10466979
325 Ga0207643_10437385
326 Ga0207705_10200073
327 Ga0207654_10000461
328 Ga0207654_10723970
329 Ga0207707_10000189
330 Ga0207695_10005484
331 Ga0207671_10456174
332 Ga0207671_10503535
333 Ga0207660_10021105
334 Ga0207652_10000488
335 Ga0207650_10343393
336 Ga0207650_10427537
337 Ga0207650_10565359
338 Ga0207659_10173913
339 Ga0207667_10110361
340 Ga0207668_11293827
341 Ga0207658_10112902
342 Ga0207658_10509713
343 Ga0207639_10012101
344 Ga0207639_10089332
345 Ga0207639_10538046
346 Ga0207639_11142231
347 Ga0207641_12639301
348 Ga0207648_10081468
349 Ga0207674_11485930
350 Ga0207683_10082258
351 Ga0307515_10000251
352 Ga0307515_10166276
353 Ga0307508_10001604
354 Ga0307413_10293837
355 Ga0307413_10806975
356 Ga0307412_10385019
357 Ga0307414_10274825
358 Ga0307414_11172591
359 Ga0307414_11828295
360 Ga0439436_0044412
361 Ga0451853_0402783
362 Ga0439431_0001683
363 Ga0439431_0221161
364 Ga0439457_063679
365 Ga0451577_0021778
366 Ga0453684_1408821
367 Ga0466960_0112596
368 Ga0466959_0042368
369 Ga0451576_0696238
370 Ga0495625_0028672
371 Ga0495600_0195258
372 Ga0495672_0095000
373 Ga0496121_0000028
374 Ga0496126_0037459
375 Ga0501307_071763
376 Ga0501292_015313
377 Ga0501296_004227
378 Ga0501298_011166
379 Ga0501300_020076
380 Ga0501332_19474
381 Ga0501336_008234
382 Ga0501033_0073028
383 Ga0501034_0170724
384 Ga0501047_0009758
385 Ga0501199_030020
386 Ga0501201_009248
387 Ga0501202_001001
388 Ga0501202_157518
389 Ga0501206_002723
390 Ga0501207_009883
391 Ga0501208_015250
392 Ga0501209_108818
393 Ga0501217_001447
394 Ga0501223_023596
395 Ga0501227_071153
396 Ga0501233_055454
397 Ga0501235_001131
398 Ga0501235_022449
399 Ga0501238_013477
400 Ga0501238_025832
401 Ga0501240_001076
402 Ga0501242_024939
403 Ga0501243_000076
404 Ga0501252_000646
405 Ga0501253_123165
406 Ga0501257_038208
407 Ga0501259_010551
408 Ga0501261_000749
409 Ga0501221_000930
410 Ga0501225_0046375
411 Ga0501229_016269
412 Ga0501234_012189
413 Ga0501245_002536
414 Ga0501245_030734
415 Ga0501241_024527
416 Ga0501241_122915
417 Ga0501283_069707
418 Ga0501212_015296
419 Ga0501212_031603
420 nmdc:mga07m45_539004_c1
421 Ga0500646_0086232
422 Ga0500562_022481
423 Ga0500594_0075827
424 Ga0500652_002787
425 Ga0500604_0050300
426 Ga0500616_0279239
427 Ga0500622_0001037
428 Ga0500645_016518
429 2819572851
430 2821139735
431 2883069302
432 2884794867
433 2896088205
434 2896112058
435 2904473513
436 2929179495
437 2929244638
438 2929926768
439 2945981905
440 2946018696
441 8003156237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00403

HMA

Heavy-metal-associated domain

47

107

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxs-assembly1.cif.gz_X crystal structure of a copper binding domain from hma7, a p-type atpase 0.962 30 95
6a71-assembly1.cif.gz_B crystal structure of human atp7b and tm complex 0.9516 29 95
6ff2-assembly1.cif.gz_B copz metallochaperone 0.945 29 94
2qif-assembly1.cif.gz_A crystal structure of a metallochaperone with a tetranuclear cu(i) cluster 0.9393 29 94
2aw0-assembly1.cif.gz_A fourth metal-binding domain of the menkes copper-transporting atpase, nmr, 20 structures 0.9289 28 95
ID Description Score Start End Superfamily
af_Q54Q77_23_93_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.982 28 95 3.30.70.100
af_G5EE14_248_322_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9742 28 94 3.30.70.100
af_G5EE14_328_399_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9654 29 95 3.30.70.100
af_P70705_554_627_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9643 28 95 3.30.70.100
af_I1JA65_34_107_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9638 28 95 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A847JY81-F1-model_v4 Heavy-metal-associated domain-containing protein 0.988 28 95 GO:0046872
AF-A0A7V0V7D3-F1-model_v4 Copper chaperone 0.9797 28 95 GO:0046872
AF-A0A356R7X3-F1-model_v4 Copper-translocating P-type ATPase 0.9745 26 94 GO:0005507
GO:0005524
GO:0016020
GO:0016887
GO:0043682
GO:0055070
AF-A0A1V1REK3-F1-model_v4 Cation transport ATPase 0.9739 28 95 GO:0046872
AF-A0A2M7TAZ2-F1-model_v4 HMA domain-containing protein 0.9721 27 95 GO:0046872

Map