F332620

General Info

Members Datasets Scaffolds Average Seq Length
220 171 206 408

Family's Representative Sequence

Representative Sequence 3300046680|Ga0495646_0064633|Ga0495646_0064633_369_1769
Length 466
Sequence MCSNWKYRILNSFLVERWPDLAMLDHAARHGVLMDGDRRAGFSGQHQETQMAGIGPLYHALTRRRLLGAAGVGAIALSNVALAKPGWAETMTELPLPGGPGARPITTAFPQKGPMILQRTRPPLLETPFEVFDKGVFTPADQFYVRWHWAVIPTDIDTAKFALTVRGHVNQTLSLFLNDLLRGLPGVQLAAVNQCSGNSRGFFQPRVPGGEWANGAMGNAVWTGVRLKDVLDKAGVKPGAVQVRFKGLDDPVVSDAPHFMKSLDIEHARDGEVMIAYAMNGEQLPLVNGFPLRLVVPGWYATYWVKMLSDIEVLDQPDTNYWTKVAYTIPDTPHASIKPGETGVKMIPINRMVPRSFVTNIPSGQKVKAAAQTGVRGIAFGGDCGVAKVDYSIDRGQSWRPAQLGEDKGKYGFRRWGTQINLPSPGAYTVMTRCTNANGVVQPDTPNWNPAGFMRNVVESVDLIAI

Samples

Sample ID Description Type Environment
1 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
2 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
3 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
4 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
5 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
6 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
7 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
8 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
9 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
10 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
11 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
108 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
169 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
170 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
171 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.18
Metatranscriptomes 0.45
Isolates 6.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.82
Nodule 3.64
Rhizoplane 5
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000794 3300003187 Bacteria 25432
2 rootH1_10044700 3300003323 Bacteria 9806
3 JGI25404J52841_10012677 3300003659 Bacteria 1827
4 Ga0070671_100007123 3300005355 Bacteria 8940
5 Ga0070667_100006809 3300005367 Bacteria 9492
6 Ga0070667_100266391 3300005367 Bacteria 1535
7 Ga0070714_100030555 3300005435 Bacteria 4485
8 Ga0070713_100012212 3300005436 Bacteria 6292
9 Ga0070713_100075499 3300005436 Bacteria 2859
10 Ga0070713_100171524 3300005436 Bacteria 1944
11 Ga0070710_10028017 3300005437 Bacteria 3010
12 Ga0070710_10029965 3300005437 Bacteria 2924
13 Ga0070711_100072802 3300005439 Bacteria 2425
14 Ga0070708_100064668 3300005445 Bacteria 3278
15 Ga0070706_100025339 3300005467 Bacteria 5458
16 Ga0070698_100010025 3300005471 Bacteria 10122
17 Ga0070698_100044677 3300005471 Bacteria 4534
18 Ga0070699_100019176 3300005518 Bacteria 5885
19 Ga0070699_100253672 3300005518 Bacteria 1572
20 Ga0070697_100103432 3300005536 Bacteria 2367
21 Ga0070695_100053915 3300005545 Bacteria 2587
22 Ga0070665_100017851 3300005548 Bacteria 7123
23 Ga0070665_100017958 3300005548 Bacteria 7102
24 Ga0068855_100079228 3300005563 Bacteria 3811
25 Ga0070664_100155451 3300005564 Bacteria 2021
26 Ga0068859_100032759 3300005617 Bacteria 5220
27 Ga0068861_100141971 3300005719 Bacteria 1961
28 Ga0068861_100183555 3300005719 Bacteria 1743
29 Ga0068863_100044249 3300005841 Bacteria 4226
30 Ga0068858_100025439 3300005842 Bacteria 5507
31 Ga0081540_1000627 3300005983 Bacteria 33631
32 Ga0081540_1016108 3300005983 Bacteria 4699
33 Ga0070717_10001536 3300006028 Bacteria 16015
34 Ga0070717_10010317 3300006028 Bacteria 7047
35 Ga0075365_10021632 3300006038 Bacteria 4015
36 Ga0075365_10031840 3300006038 Bacteria 3386
37 Ga0075365_10065550 3300006038 Bacteria 2435
38 Ga0070712_100019511 3300006175 Bacteria 4423
39 Ga0075367_10013312 3300006178 Bacteria 4418
40 Ga0075369_10000167 3300006186 Bacteria 18850
41 Ga0075370_10025592 3300006353 Bacteria 3265
42 Ga0075370_10038537 3300006353 Bacteria 2690
43 Ga0097620_100032756 3300006931 Bacteria 5220
44 Ga0075435_100103688 3300007076 Bacteria 2359
45 Ga0099794_10009389 3300007265 Bacteria 4111
46 Ga0099794_10014044 3300007265 Bacteria 3500
47 Ga0099794_10038092 3300007265 Bacteria 2277
48 Ga0099795_10007493 3300007788 Bacteria 3050
49 Ga0105240_10091116 3300009093 Bacteria 3725
50 Ga0105247_10002556 3300009101 Bacteria 12342
51 Ga0114129_10351704 3300009147 Bacteria 1952
52 Ga0105238_10009525 3300009551 Bacteria 9722
53 Ga0105249_10028502 3300009553 Bacteria 5040
54 Ga0099796_10000401 3300010159 Bacteria 7111
55 Ga0157369_10278291 3300013105 Bacteria 1743
56 Ga0163163_10107380 3300014325 Bacteria 2818
57 Ga0157379_10045559 3300014968 Bacteria 3914
58 Ga0157379_10134493 3300014968 Bacteria 2227
59 Ga0209258_101937 3300025242 Bacteria 6068
60 Ga0209148_1000399 3300025254 Bacteria 50703
61 Ga0209130_1000422 3300025284 Bacteria 45627
62 Ga0209025_1000053 3300025294 Bacteria 317600
63 Ga0209758_1002069 3300025297 Bacteria 21429
64 Ga0207426_1000198 3300025302 Bacteria 146241
65 Ga0207692_10009916 3300025898 Bacteria 3993
66 Ga0207684_10132112 3300025910 Bacteria 2142
67 Ga0207695_10003854 3300025913 Bacteria 20763
68 Ga0207695_10077591 3300025913 Bacteria 3373
69 Ga0207693_10017678 3300025915 Bacteria 5685
70 Ga0207693_10027634 3300025915 Bacteria 4485
71 Ga0207663_10071673 3300025916 Bacteria 2237
72 Ga0207646_10012239 3300025922 Bacteria 8254
73 Ga0207700_10047342 3300025928 Bacteria 3186
74 Ga0207700_10065961 3300025928 Bacteria 2764
75 Ga0207700_10209625 3300025928 Bacteria 1647
76 Ga0207700_10304962 3300025928 Bacteria 1376
77 Ga0207665_10002062 3300025939 Bacteria 13545
78 Ga0207665_10063619 3300025939 Bacteria 2506
79 Ga0207711_10065121 3300025941 Bacteria 3150
80 Ga0207679_10076689 3300025945 Bacteria 2541
81 Ga0207667_10061502 3300025949 Bacteria 3928
82 Ga0207668_10001713 3300025972 Bacteria 12828
83 Ga0207677_10165871 3300026023 Bacteria 1721
84 Ga0207703_10059474 3300026035 Bacteria 3121
85 Ga0207703_10114413 3300026035 Bacteria 2307
86 Ga0207678_10087618 3300026067 Bacteria 2661
87 Ga0207675_100053048 3300026118 Bacteria 3784
88 Ga0209179_1001877 3300027512 Bacteria 2703
89 Ga0209588_1005734 3300027671 Bacteria 3570
90 Ga0209588_1032001 3300027671 Bacteria 1684
91 Ga0268266_10008307 3300028379 Bacteria 9243
92 Ga0268266_10010554 3300028379 Bacteria 8065
93 Ga0268264_10011154 3300028381 Bacteria 7424
94 Ga0307511_10008638 3300030521 Bacteria 10184
95 Ga0265760_10000905 3300031090 Bacteria 8567
96 Ga0265331_10060743 3300031250 Bacteria 1785
97 Ga0307509_10043451 3300031507 Bacteria 4863
98 Ga0307510_10000008 3300033180 Bacteria 433990
99 Ga0373934_0006549 3300035086 Bacteria 4321
100 Ga0373953_0002813 3300035117 Bacteria 5291
101 Ga0373954_0001354 3300035118 Bacteria 9877
102 Ga0373957_0005833 3300035120 Bacteria 3843
103 Ga0373927_0078730 3300035695 Bacteria 2135
104 Ga0373927_0185225 3300035695 Bacteria 1366
105 Ga0373933_0001089 3300035724 Bacteria 16221
106 Ga0373937_0006280 3300036401 Bacteria 10247
107 Ga0373937_0061030 3300036401 Bacteria 3466
108 Ga0373937_0118442 3300036401 Bacteria 2467
109 Ga0436362_0339351 3300039453 Bacteria 5035
110 Ga0451577_0029441 3300042876 Bacteria 4964
111 Ga0453683_0112881 3300044673 Bacteria 1709
112 Ga0466966_0022703 3300044684 Plasmid 4114
113 Ga0453684_0068772 3300044712 Bacteria 4495
114 Ga0495592_0008630 3300046454 Bacteria 7648
115 Ga0495603_0035341 3300046455 Bacteria 3002
116 Ga0495629_0002307 3300046459 Bacteria 14715
117 Ga0495629_0028233 3300046459 Bacteria 3983
118 Ga0495638_0019762 3300046460 Bacteria 4453
119 Ga0495651_0219337 3300046462 Bacteria 1317
120 Ga0495653_0013015 3300046463 Bacteria 6786
121 Ga0495580_0011677 3300046472 Bacteria 6791
122 Ga0495639_0016168 3300046475 Bacteria 3238
123 Ga0495664_0020874 3300046477 Bacteria 3781
124 Ga0495608_0002629 3300046511 Bacteria 12898
125 Ga0495610_0027455 3300046512 Bacteria 3024
126 Ga0495616_0089873 3300046513 Bacteria 1456
127 Ga0495632_0052049 3300046519 Bacteria 2014
128 Ga0495648_0117844 3300046524 Bacteria 1432
129 Ga0495642_0001260 3300046528 Bacteria 11512
130 Ga0495652_0020160 3300046529 Bacteria 5926
131 Ga0495640_0015625 3300046533 Bacteria 5705
132 Ga0495586_0075855 3300046535 Bacteria 1841
133 Ga0495609_0042634 3300046538 Bacteria 2038
134 Ga0495645_0001395 3300046543 Bacteria 16327
135 Ga0495645_0002685 3300046543 Bacteria 12074
136 Ga0495667_0013388 3300046559 Bacteria 5552
137 Ga0495625_0050745 3300046660 Bacteria 2976
138 Ga0495635_0002628 3300046663 Bacteria 12288
139 Ga0495657_0061120 3300046675 Bacteria 2492
140 Ga0495599_0006861 3300046678 Bacteria 6885
141 Ga0495599_0009541 3300046678 Bacteria 5934
142 Ga0495599_0045339 3300046678 Bacteria 2757
143 Ga0495623_0071828 3300046679 Bacteria 2152
144 Ga0495646_0064633 3300046680 Bacteria 2168
145 Ga0495646_0124959 3300046680 Bacteria 1452
146 Ga0495669_0043763 3300046684 Bacteria 1994
147 Ga0495613_0104366 3300046689 Bacteria 2046
148 Ga0495649_0133562 3300046694 Bacteria 1309
149 Ga0495589_0017478 3300046794 Bacteria 3680
150 Ga0495600_0063902 3300046809 Bacteria 2405
151 Ga0495600_0105697 3300046809 Bacteria 1834
152 Ga0495581_0016890 3300047315 Bacteria 4241
153 Ga0495581_0043721 3300047315 Bacteria 2591
154 Ga0495604_0083820 3300047317 Bacteria 2381
155 Ga0495674_0001531 3300047319 Bacteria 22599
156 Ga0495674_0023844 3300047319 Bacteria 5631
157 Ga0495672_0016293 3300047320 Bacteria 5016
158 Ga0495672_0046811 3300047320 Bacteria 2577
159 Ga0495680_0002436 3300047322 Bacteria 19039
160 Ga0495680_0138892 3300047322 Bacteria 1779
161 Ga0495680_0196515 3300047322 Bacteria 1449
162 Ga0495675_0029300 3300047444 Bacteria 3510
163 Ga0495675_0081617 3300047444 Bacteria 2036
164 Ga0495679_025631 3300047446 Bacteria 1969
165 Ga0495684_0063367 3300047471 Bacteria 2810
166 Ga0495686_0067766 3300047472 Bacteria 2203
167 Ga0495593_0002110 3300047673 Bacteria 11877
168 Ga0495602_0024702 3300048088 Bacteria 5828
169 Ga0495602_0182417 3300048088 Bacteria 1617
170 Ga0496101_0048873 3300048904 Bacteria 3041
171 Ga0496102_0021058 3300048905 Bacteria 5766
172 Ga0496102_0252486 3300048905 Bacteria 1663
173 Ga0496104_0139973 3300048907 Bacteria 2325
174 Ga0496105_0038230 3300048908 Bacteria 3953
175 Ga0496106_0067144 3300048909 Bacteria 2733
176 Ga0496107_0051594 3300048910 Bacteria 2967
177 Ga0496111_0046650 3300048914 Bacteria 3120
178 Ga0496112_0182186 3300048915 Bacteria 2064
179 Ga0496112_0334853 3300048915 Bacteria 1457
180 Ga0496114_0032817 3300048917 Bacteria 4276
181 Ga0496121_0002128 3300048924 Bacteria 31122
182 Ga0496121_0002313 3300048924 Bacteria 29539
183 Ga0496125_0046261 3300048928 Bacteria 3652
184 Ga0496126_0002713 3300048929 Bacteria 23398
185 Ga0496126_0022816 3300048929 Bacteria 6078
186 Ga0496126_0052803 3300048929 Bacteria 3691
187 Ga0495682_0037357 3300049460 Bacteria 1787
188 Ga0501046_0104144 3300049580 Bacteria 2175
189 Ga0501048_0000737 3300049582 Bacteria 23982
190 Ga0501073_0125771 3300049589 Bacteria 1777
191 Ga0501080_0032667 3300049742 Bacteria 4855
192 Ga0501083_0006258 3300049744 Bacteria 8448
193 nmdc:mga03683_1455_c1 3300050489 Bacteria 7069
194 nmdc:mga0yw44_238710_c1 3300050492 Bacteria 1208
195 nmdc:mga0yw44_56939_c1 3300050492 Bacteria 2383
196 nmdc:mga0k408_3517_c1 3300050493 Bacteria 8280
197 nmdc:mga06z11_107820_c1 3300050494 Bacteria 1538
198 nmdc:mga06z11_175962_c1 3300050494 Bacteria 1231
199 nmdc:mga06z11_5963_c1 3300050494 Bacteria 4922
200 nmdc:mga07m45_7271_c1 3300050496 Bacteria 4744
201 nmdc:mga0sz30_524_c1 3300050516 Bacteria 14308
202 Ga0495595_0000180 3300053084 Bacteria 25223
203 Ga0495619_0003341 3300053085 Bacteria 10377
204 Ga0500595_010824 3300053119 Bacteria 3603
205 Ga0500568_0014078 3300053139 Bacteria 3624
206 Ga0500637_0003661 3300053178 Bacteria 7149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050494 nmdc:mga06z11_175962_c1 nmdc:mga06z11_175962_c1_16_1071 350
2 3300046524 Ga0495648_0117844 Ga0495648_0117844_321_1379 351
3 3300047322 Ga0495680_0138892 Ga0495680_0138892_367_1479 358
4 3300005518 Ga0070699_100253672 Ga0070699_1002536721 370
5 3300035695 Ga0373927_0185225 Ga0373927_0185225_223_1350 374
6 3300007788 Ga0099795_10007493 Ga0099795_100074933 375
7 3300046689 Ga0495613_0104366 Ga0495613_0104366_115_1245 375
8 3300042876 Ga0451577_0029441 Ga0451577_0029441_507_1643 377
9 3300044673 Ga0453683_0112881 Ga0453683_0112881_323_1459 377
10 3300044712 Ga0453684_0068772 Ga0453684_0068772_3299_4435 377
11 iso_pu_bacteria 8016630954 8016631067 377
12 3300046535 Ga0495586_0075855 Ga0495586_0075855_20_1237 380
13 3300050492 nmdc:mga0yw44_238710_c1 nmdc:mga0yw44_238710_c1_42_1190 381
14 3300053139 Ga0500568_0014078 Ga0500568_0014078_1883_3115 385
15 3300009147 Ga0114129_10351704 Ga0114129_103517041 386
16 3300046477 Ga0495664_0020874 Ga0495664_0020874_750_1988 386
17 3300046678 Ga0495599_0009541 Ga0495599_0009541_2828_4066 386
18 3300046678 Ga0495599_0045339 Ga0495599_0045339_1142_2380 386
19 3300047317 Ga0495604_0083820 Ga0495604_0083820_793_2031 386
20 3300047322 Ga0495680_0196515 Ga0495680_0196515_91_1329 386
21 3300047444 Ga0495675_0081617 Ga0495675_0081617_644_1882 386
22 3300048088 Ga0495602_0024702 Ga0495602_0024702_2257_3495 386
23 3300005983 Ga0081540_1016108 Ga0081540_10161089 387
24 3300047319 Ga0495674_0001531 Ga0495674_0001531_11672_12904 387
25 3300047320 Ga0495672_0016293 Ga0495672_0016293_25_1203 387
26 3300047472 Ga0495686_0067766 Ga0495686_0067766_405_1580 390
27 3300050494 nmdc:mga06z11_107820_c1 nmdc:mga06z11_107820_c1_84_1259 390
28 3300046460 Ga0495638_0019762 Ga0495638_0019762_749_1930 392
29 3300046513 Ga0495616_0089873 Ga0495616_0089873_104_1285 392
30 3300046519 Ga0495632_0052049 Ga0495632_0052049_478_1659 392
31 3300046538 Ga0495609_0042634 Ga0495609_0042634_766_1947 392
32 3300046660 Ga0495625_0050745 Ga0495625_0050745_416_1597 392
33 3300046684 Ga0495669_0043763 Ga0495669_0043763_206_1387 392
34 3300046694 Ga0495649_0133562 Ga0495649_0133562_10_1191 392
35 3300047320 Ga0495672_0046811 Ga0495672_0046811_678_1859 392
36 3300049460 Ga0495682_0037357 Ga0495682_0037357_309_1490 392
37 3300005471 Ga0070698_100044677 Ga0070698_1000446772 393
38 3300036401 Ga0373937_0118442 Ga0373937_0118442_217_1470 393
39 3300046680 Ga0495646_0124959 Ga0495646_0124959_243_1439 393
40 3300028379 Ga0268266_10008307 Ga0268266_100083073 394
41 3300053119 Ga0500595_010824 Ga0500595_010824_2366_3553 394
42 3300014325 Ga0163163_10107380 Ga0163163_101073803 395
43 3300039453 Ga0436362_0339351 Ga0436362_0339351_3161_4399 395
44 3300048924 Ga0496121_0002313 Ga0496121_0002313_24734_25966 395
45 3300035086 Ga0373934_0006549 Ga0373934_0006549_2133_3338 396
46 3300035117 Ga0373953_0002813 Ga0373953_0002813_1479_2684 396
47 3300035118 Ga0373954_0001354 Ga0373954_0001354_6056_7261 396
48 3300035120 Ga0373957_0005833 Ga0373957_0005833_2241_3446 396
49 3300036401 Ga0373937_0006280 Ga0373937_0006280_5336_6541 396
50 3300046454 Ga0495592_0008630 Ga0495592_0008630_4450_5655 396
51 3300046462 Ga0495651_0219337 Ga0495651_0219337_76_1281 396
52 3300046463 Ga0495653_0013015 Ga0495653_0013015_5410_6615 396
53 3300046511 Ga0495608_0002629 Ga0495608_0002629_10812_12017 396
54 3300046529 Ga0495652_0020160 Ga0495652_0020160_2491_3696 396
55 3300046533 Ga0495640_0015625 Ga0495640_0015625_4235_5440 396
56 3300046543 Ga0495645_0002685 Ga0495645_0002685_9096_10301 396
57 3300046559 Ga0495667_0013388 Ga0495667_0013388_4311_5516 396
58 3300046663 Ga0495635_0002628 Ga0495635_0002628_9501_10706 396
59 3300046675 Ga0495657_0061120 Ga0495657_0061120_793_1998 396
60 3300046678 Ga0495599_0006861 Ga0495599_0006861_1100_2305 396
61 3300046679 Ga0495623_0071828 Ga0495623_0071828_352_1557 396
62 3300046809 Ga0495600_0063902 Ga0495600_0063902_985_2190 396
63 3300047322 Ga0495680_0002436 Ga0495680_0002436_3950_5155 396
64 3300047444 Ga0495675_0029300 Ga0495675_0029300_201_1406 396
65 3300047471 Ga0495684_0063367 Ga0495684_0063367_1010_2215 396
66 3300047673 Ga0495593_0002110 Ga0495593_0002110_256_1461 396
67 3300053084 Ga0495595_0000180 Ga0495595_0000180_14729_15934 396
68 3300053085 Ga0495619_0003341 Ga0495619_0003341_745_1950 396
69 3300031090 Ga0265760_10000905 Ga0265760_100009054 397
70 3300044684 Ga0466966_0022703 Ga0466966_0022703_1704_2903 397
71 3300005518 Ga0070699_100019176 Ga0070699_1000191762 399
72 3300005563 Ga0068855_100079228 Ga0068855_1000792284 399
73 3300009093 Ga0105240_10091116 Ga0105240_100911163 399
74 3300013105 Ga0157369_10278291 Ga0157369_102782912 399
75 3300025922 Ga0207646_10012239 Ga0207646_100122396 399
76 3300046455 Ga0495603_0035341 Ga0495603_0035341_801_2036 399
77 iso_pu_bacteria 2595698237 2596376768 399
78 3300025913 Ga0207695_10077591 Ga0207695_100775913 400
79 3300025949 Ga0207667_10061502 Ga0207667_100615024 400
80 3300010159 Ga0099796_10000401 Ga0099796_100004012 401
81 3300025284 Ga0209130_1000422 Ga0209130_10004226 401
82 3300025302 Ga0207426_1000198 Ga0207426_1000198112 401
83 iso_pu_bacteria 3003665799 3003671762 401
84 3300006353 Ga0075370_10025592 Ga0075370_100255925 402
85 3300046459 Ga0495629_0002307 Ga0495629_0002307_10232_11470 402
86 3300046472 Ga0495580_0011677 Ga0495580_0011677_2336_3574 402
87 3300046475 Ga0495639_0016168 Ga0495639_0016168_353_1591 402
88 3300046528 Ga0495642_0001260 Ga0495642_0001260_7999_9237 402
89 3300046543 Ga0495645_0001395 Ga0495645_0001395_394_1632 402
90 3300046794 Ga0495589_0017478 Ga0495589_0017478_1755_2993 402
91 3300046809 Ga0495600_0105697 Ga0495600_0105697_228_1466 402
92 3300047315 Ga0495581_0016890 Ga0495581_0016890_686_1924 402
93 3300047446 Ga0495679_025631 Ga0495679_025631_652_1890 402
94 3300048904 Ga0496101_0048873 Ga0496101_0048873_783_2021 402
95 3300048907 Ga0496104_0139973 Ga0496104_0139973_397_1635 402
96 3300048908 Ga0496105_0038230 Ga0496105_0038230_1915_3153 402
97 3300048917 Ga0496114_0032817 Ga0496114_0032817_779_2017 402
98 3300050493 nmdc:mga0k408_3517_c1 nmdc:mga0k408_3517_c1_4973_6211 402
99 3300053178 Ga0500637_0003661 Ga0500637_0003661_3261_4499 402
100 3300005355 Ga0070671_100007123 Ga0070671_1000071232 403
101 3300005367 Ga0070667_100006809 Ga0070667_1000068095 403
102 3300005445 Ga0070708_100064668 Ga0070708_1000646682 403
103 3300005467 Ga0070706_100025339 Ga0070706_1000253394 403
104 3300005536 Ga0070697_100103432 Ga0070697_1001034322 403
105 3300005617 Ga0068859_100032759 Ga0068859_1000327595 403
106 3300005841 Ga0068863_100044249 Ga0068863_1000442494 403
107 3300005842 Ga0068858_100025439 Ga0068858_1000254394 403
108 3300006931 Ga0097620_100032756 Ga0097620_1000327565 403
109 3300007265 Ga0099794_10014044 Ga0099794_100140442 403
110 3300009101 Ga0105247_10002556 Ga0105247_100025564 403
111 3300014968 Ga0157379_10134493 Ga0157379_101344932 403
112 3300025913 Ga0207695_10003854 Ga0207695_1000385412 403
113 3300025941 Ga0207711_10065121 Ga0207711_100651212 403
114 3300026035 Ga0207703_10059474 Ga0207703_100594742 403
115 3300028381 Ga0268264_10011154 Ga0268264_100111544 403
116 3300030521 Ga0307511_10008638 Ga0307511_1000863810 403
117 3300048905 Ga0496102_0252486 Ga0496102_0252486_216_1460 403
118 3300048915 Ga0496112_0182186 Ga0496112_0182186_762_2006 403
119 3300048924 Ga0496121_0002128 Ga0496121_0002128_8630_9874 403
120 3300048928 Ga0496125_0046261 Ga0496125_0046261_2063_3307 403
121 3300049580 Ga0501046_0104144 Ga0501046_0104144_917_2131 403
122 3300006038 Ga0075365_10021632 Ga0075365_100216324 404
123 3300006353 Ga0075370_10038537 Ga0075370_100385373 404
124 3300050489 nmdc:mga03683_1455_c1 nmdc:mga03683_1455_c1_5638_6861 404
125 3300050492 nmdc:mga0yw44_56939_c1 nmdc:mga0yw44_56939_c1_365_1588 404
126 3300050494 nmdc:mga06z11_5963_c1 nmdc:mga06z11_5963_c1_721_1944 404
127 3300050496 nmdc:mga07m45_7271_c1 nmdc:mga07m45_7271_c1_3463_4686 404
128 3300050516 nmdc:mga0sz30_524_c1 nmdc:mga0sz30_524_c1_7372_8595 404
129 iso_pu_bacteria 2883354860 2883359988 404
130 3300007265 Ga0099794_10038092 Ga0099794_100380922 405
131 iso_pu_bacteria 8006984368 8006993932 406
132 iso_pu_bacteria 2524023228 2524533867 407
133 iso_pu_bacteria 2935630451 2935636315 407
134 iso_pu_bacteria 2941507105 2941512946 407
135 iso_pu_bacteria 2941515067 2941520752 407
136 iso_pu_bacteria 2941523033 2941528767 407
137 3300025242 Ga0209258_101937 Ga0209258_1019373 408
138 3300005437 Ga0070710_10028017 Ga0070710_100280174 409
139 3300005439 Ga0070711_100072802 Ga0070711_1000728022 409
140 3300005471 Ga0070698_100010025 Ga0070698_10001002510 409
141 3300005564 Ga0070664_100155451 Ga0070664_1001554512 409
142 3300006028 Ga0070717_10010317 Ga0070717_100103175 409
143 3300009551 Ga0105238_10009525 Ga0105238_100095253 409
144 3300025898 Ga0207692_10009916 Ga0207692_100099163 409
145 3300025916 Ga0207663_10071673 Ga0207663_100716732 409
146 3300025928 Ga0207700_10209625 Ga0207700_102096252 409
147 3300025945 Ga0207679_10076689 Ga0207679_100766892 409
148 3300035695 Ga0373927_0078730 Ga0373927_0078730_249_1481 409
149 3300048929 Ga0496126_0022816 Ga0496126_0022816_315_1547 409
150 iso_pu_bacteria 2524023210 2524464675 409
151 iso_pu_bacteria 2885383462 2885386230 409
152 iso_pu_bacteria 2903768456 2903772847 409
153 3300003659 JGI25404J52841_10012677 JGI25404J52841_100126771 410
154 3300005435 Ga0070714_100030555 Ga0070714_1000305552 410
155 3300005436 Ga0070713_100012212 Ga0070713_1000122124 410
156 3300005436 Ga0070713_100075499 Ga0070713_1000754992 410
157 3300005436 Ga0070713_100171524 Ga0070713_1001715242 410
158 3300005437 Ga0070710_10029965 Ga0070710_100299654 410
159 3300005719 Ga0068861_100141971 Ga0068861_1001419711 410
160 3300005983 Ga0081540_1000627 Ga0081540_100062729 410
161 3300006028 Ga0070717_10001536 Ga0070717_100015364 410
162 3300006175 Ga0070712_100019511 Ga0070712_1000195113 410
163 3300007265 Ga0099794_10009389 Ga0099794_100093894 410
164 3300009553 Ga0105249_10028502 Ga0105249_100285024 410
165 3300025254 Ga0209148_1000399 Ga0209148_100039912 410
166 3300025910 Ga0207684_10132112 Ga0207684_101321121 410
167 3300025915 Ga0207693_10017678 Ga0207693_100176787 410
168 3300025915 Ga0207693_10027634 Ga0207693_100276343 410
169 3300025928 Ga0207700_10047342 Ga0207700_100473421 410
170 3300025928 Ga0207700_10065961 Ga0207700_100659613 410
171 3300025939 Ga0207665_10063619 Ga0207665_100636192 410
172 3300025972 Ga0207668_10001713 Ga0207668_1000171311 410
173 3300027671 Ga0209588_1005734 Ga0209588_10057344 410
174 3300027671 Ga0209588_1032001 Ga0209588_10320012 410
175 3300031250 Ga0265331_10060743 Ga0265331_100607431 410
176 3300048915 Ga0496112_0334853 Ga0496112_0334853_177_1412 410
177 3300049582 Ga0501048_0000737 Ga0501048_0000737_16255_17493 410
178 3300007076 Ga0075435_100103688 Ga0075435_1001036882 411
179 3300025928 Ga0207700_10304962 Ga0207700_103049621 411
180 3300025939 Ga0207665_10002062 Ga0207665_1000206210 411
181 3300027512 Ga0209179_1001877 Ga0209179_10018771 411
182 3300031507 Ga0307509_10043451 Ga0307509_100434514 411
183 3300049589 Ga0501073_0125771 Ga0501073_0125771_254_1498 411
184 3300049742 Ga0501080_0032667 Ga0501080_0032667_1301_2545 411
185 3300049744 Ga0501083_0006258 Ga0501083_0006258_3485_4729 411
186 3300003323 rootH1_10044700 rootH1_100447007 412
187 3300005548 Ga0070665_100017851 Ga0070665_1000178516 412
188 3300005548 Ga0070665_100017958 Ga0070665_1000179586 412
189 3300006038 Ga0075365_10031840 Ga0075365_100318403 412
190 3300026067 Ga0207678_10087618 Ga0207678_100876182 412
191 3300028379 Ga0268266_10010554 Ga0268266_1001055411 412
192 3300033180 Ga0307510_10000008 Ga0307510_10000008100 412
193 3300006038 Ga0075365_10065550 Ga0075365_100655502 413
194 3300006178 Ga0075367_10013312 Ga0075367_100133126 413
195 3300006186 Ga0075369_10000167 Ga0075369_100001672 413
196 3300048929 Ga0496126_0002713 Ga0496126_0002713_3603_4889 413
197 3300048929 Ga0496126_0052803 Ga0496126_0052803_807_2090 413
198 iso_pu_bacteria 8056681323 8056684724 413
199 3300003187 JGI25151J46595_10000794 JGI25151J46595_1000079415 414
200 3300005367 Ga0070667_100266391 Ga0070667_1002663912 414
201 3300005545 Ga0070695_100053915 Ga0070695_1000539153 414
202 3300005719 Ga0068861_100183555 Ga0068861_1001835552 414
203 3300014968 Ga0157379_10045559 Ga0157379_100455595 414
204 3300025294 Ga0209025_1000053 Ga0209025_100005397 414
205 3300025297 Ga0209758_1002069 Ga0209758_10020697 414
206 3300026023 Ga0207677_10165871 Ga0207677_101658711 414
207 3300026035 Ga0207703_10114413 Ga0207703_101144132 414
208 3300026118 Ga0207675_100053048 Ga0207675_1000530484 414
209 3300035724 Ga0373933_0001089 Ga0373933_0001089_4478_5812 414
210 3300036401 Ga0373937_0061030 Ga0373937_0061030_1137_2393 414
211 3300046459 Ga0495629_0028233 Ga0495629_0028233_21_1355 414
212 3300046512 Ga0495610_0027455 Ga0495610_0027455_689_1933 414
213 3300046680 Ga0495646_0064633 Ga0495646_0064633_369_1769 414
214 3300047315 Ga0495581_0043721 Ga0495581_0043721_146_1480 414
215 3300047319 Ga0495674_0023844 Ga0495674_0023844_2223_3623 414
216 3300048088 Ga0495602_0182417 Ga0495602_0182417_72_1472 414
217 3300048905 Ga0496102_0021058 Ga0496102_0021058_2546_3802 414
218 3300048909 Ga0496106_0067144 Ga0496106_0067144_1001_2257 414
219 3300048910 Ga0496107_0051594 Ga0496107_0051594_1206_2462 414
220 3300048914 Ga0496111_0046650 Ga0496111_0046650_587_1843 414

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

149

322

0.96

PF03404

Mo-co_dimer

Mo-co oxidoreductase dimerisation domain

346

465

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.9708 39 414
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.9698 39 414
2bpb-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella 0.9697 40 414
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.9695 40 414
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.9657 39 414
ID Description Score Start End Superfamily
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9709 39 299 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9636 39 299 3.90.420.10
2bpbA02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9458 300 414 2.60.40.650
2bpbA02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9379 300 414 2.60.40.650
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9295 64 278 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A5C8WLF5-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9806 64 414 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A0S6WR17-F1-model_v4 Sulfite dehydrogenase (Cytochrome) subunit SorA apoprotein 0.977 55 414 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A4V1TEJ6-F1-model_v4 deleted 0.9756 50 270
AF-A0A5C8WLF5-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9751 64 414 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A257P2W5-F1-model_v4 Oxidase 0.9744 47 414 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546

Feature Viewer

pLDDT pTM Quality
84.14 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map