F332550

General Info

Members Datasets Scaffolds Average Seq Length
220 145 440 257

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0255304|Ga0466967_0255304_491_1345
Length 284
Sequence VVVRLDRLAHGASGYVAAVLRVFTPSHRGGSGSPLLLLHGFTATWRAWELVLPALERRHDVLAPTLPGHAGGPPLDDDVGAAAILDAVERAMDDAGFDTAHVAGNSLGGYIALRLAARGRARSVVALAPAGGWAPGDPAARDVLAYFTRMQAQLRAAAPHAERLVATDGGRRQATQDIVTNYEHIPAELVAHGIWGAAACRGAEALIANADREGWSLDAERVACPVRIVWGTSDRLLAWPSAAVRYRRDWLPHADWVELDGIGHCPQLDVPLETAQLILGFTAG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 13.64
Rhizosphere 83.18
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0255304 3300045976 Bacteria 1676
2 Ga0070658_10005859 3300005327 Bacteria 9966
3 Ga0070683_100007498 3300005329 Bacteria 9221
4 Ga0070683_100054863 3300005329 Bacteria 3696
5 Ga0070683_100113384 3300005329 Bacteria 2559
6 Ga0070680_100019729 3300005336 Bacteria 5346
7 Ga0070682_100204766 3300005337 Unclassified 1394
8 Ga0070661_100041835 3300005344 Bacteria 3344
9 Ga0070671_100292927 3300005355 Bacteria 1385
10 Ga0070714_100279813 3300005435 Bacteria 1550
11 Ga0070713_100212644 3300005436 Bacteria 1751
12 Ga0070713_100244791 3300005436 Bacteria 1634
13 Ga0070710_10005816 3300005437 Bacteria 5880
14 Ga0070711_100005089 3300005439 Bacteria 7825
15 Ga0070711_100148372 3300005439 Bacteria 1766
16 Ga0070700_100345795 3300005441 Bacteria 1101
17 Ga0070678_100001519 3300005456 Bacteria 12388
18 Ga0070681_10048562 3300005458 Bacteria 4240
19 Ga0070684_100019476 3300005535 Bacteria 5613
20 Ga0068853_100106752 3300005539 Bacteria 2482
21 Ga0068856_100204226 3300005614 Bacteria 1990
22 Ga0068856_100324647 3300005614 Bacteria 1557
23 Ga0068866_10042840 3300005718 Bacteria 2255
24 Ga0081455_10083808 3300005937 Bacteria 2604
25 Ga0081538_10002487 3300005981 Bacteria 17972
26 Ga0081538_10019474 3300005981 Bacteria 5041
27 Ga0070717_10030606 3300006028 Bacteria 4323
28 Ga0070717_10165225 3300006028 Bacteria 1922
29 Ga0075365_10010422 3300006038 Bacteria 5414
30 Ga0075364_10068733 3300006051 Unclassified 2330
31 Ga0070712_100007827 3300006175 Bacteria 6691
32 Ga0070712_100115178 3300006175 Bacteria 2014
33 Ga0097621_100013582 3300006237 Bacteria 6073
34 Ga0075430_100149895 3300006846 Bacteria 1942
35 Ga0075431_100009364 3300006847 Bacteria 9831
36 Ga0075429_100010944 3300006880 Bacteria 7849
37 Ga0105240_10012558 3300009093 Bacteria 11684
38 Ga0111539_10367532 3300009094 Bacteria 1674
39 Ga0111539_10486424 3300009094 Bacteria 1437
40 Ga0105245_10101833 3300009098 Bacteria 2659
41 Ga0105243_10323874 3300009148 Bacteria 1405
42 Ga0105248_10490475 3300009177 Bacteria 1385
43 Ga0157370_10001705 3300013104 Bacteria 27045
44 Ga0157369_10323879 3300013105 Bacteria 1602
45 Ga0157372_10161284 3300013307 Bacteria 2591
46 Ga0157380_10310571 3300014326 Bacteria 1457
47 Ga0206353_11417191 3300020082 Bacteria 4107
48 Ga0207692_10017169 3300025898 Bacteria 3222
49 Ga0207693_10007149 3300025915 Bacteria 9204
50 Ga0207663_10051192 3300025916 Bacteria 2570
51 Ga0207657_10003888 3300025919 Bacteria 15852
52 Ga0207687_10225959 3300025927 Bacteria 1476
53 Ga0207664_10153414 3300025929 Bacteria 1959
54 Ga0207664_10219738 3300025929 Bacteria 1647
55 Ga0207661_10053596 3300025944 Bacteria 3228
56 Ga0207667_10166047 3300025949 Bacteria 2269
57 Ga0207640_10376891 3300025981 Bacteria 1148
58 Ga0207678_10037495 3300026067 Bacteria 4215
59 Ga0207702_10136603 3300026078 Bacteria 2213
60 Ga0207702_10258028 3300026078 Bacteria 1640
61 Ga0207428_10290641 3300027907 Bacteria 1211
62 Ga0265318_10001839 3300028577 Bacteria 11997
63 Ga0265338_10442118 3300028800 Bacteria 922
64 Ga0265320_10018227 3300031240 Bacteria 3872
65 Ga0265316_10029481 3300031344 Bacteria 4511
66 Ga0265313_10022769 3300031595 Bacteria 3391
67 Ga0265314_10010847 3300031711 Bacteria 7575
68 Ga0307405_10091168 3300031731 Bacteria 2019
69 Ga0307413_10718667 3300031824 Bacteria 832
70 Ga0307410_10091014 3300031852 Bacteria 2165
71 Ga0307406_10018914 3300031901 Bacteria 4035
72 Ga0307406_10089344 3300031901 Bacteria 2070
73 Ga0307406_10444268 3300031901 Bacteria 1039
74 Ga0307407_10413102 3300031903 Bacteria 971
75 Ga0307409_100217044 3300031995 Bacteria 1724
76 Ga0307414_10034639 3300032004 Bacteria 3351
77 Ga0373953_0175342 3300035117 Bacteria 924
78 Ga0373955_0113032 3300035172 Bacteria 1572
79 Ga0373924_0066532 3300035410 Bacteria 1515
80 Ga0373947_0389045 3300035725 Bacteria 939
81 Ga0395900_0000456 3300037418 Bacteria 58700
82 Ga0395900_0574558 3300037418 Unclassified 1070
83 Ga0395898_0001237 3300037466 Bacteria 38272
84 Ga0395898_0370456 3300037466 Bacteria 1366
85 Ga0395901_0420102 3300038443 Bacteria 1371
86 Ga0436363_0256580 3300039450 Unclassified 1404
87 Ga0436363_1321212 3300039450 Bacteria 2335
88 Ga0466963_0005338 3300044694 Bacteria 7515
89 Ga0466963_0007226 3300044694 Bacteria 6622
90 Ga0466963_0013030 3300044694 Bacteria 5098
91 Ga0466963_0019904 3300044694 Bacteria 4216
92 Ga0466963_0117352 3300044694 Bacteria 1829
93 Ga0466963_0329389 3300044694 Bacteria 1075
94 Ga0466964_0175983 3300044706 Bacteria 1011
95 Ga0466970_0085816 3300044765 Unclassified 1706
96 Ga0466957_0019383 3300044842 Bacteria 4001
97 Ga0466960_0039418 3300044901 Bacteria 2228
98 Ga0466959_0161492 3300045049 Unclassified 1575
99 Ga0466958_0013528 3300045836 Bacteria 4647
100 Ga0466967_0048889 3300045976 Bacteria 3696
101 Ga0466967_0054331 3300045976 Bacteria 3524
102 Ga0466967_0066122 3300045976 Bacteria 3220
103 Ga0466967_0084358 3300045976 Bacteria 2874
104 Ga0466967_0322207 3300045976 Bacteria 1491
105 Ga0495629_0082990 3300046459 Bacteria 2237
106 Ga0495641_0113091 3300046461 Bacteria 1211
107 Ga0495664_0087391 3300046477 Bacteria 1873
108 Ga0495628_0036282 3300046516 Bacteria 3958
109 Ga0495652_0182652 3300046529 Bacteria 1608
110 Ga0495652_0328093 3300046529 Bacteria 1103
111 Ga0495640_0201412 3300046533 Bacteria 1261
112 Ga0495587_0023679 3300046536 Bacteria 3772
113 Ga0495667_0005056 3300046559 Bacteria 8920
114 Ga0495635_0008925 3300046663 Bacteria 6996
115 Ga0495635_0201247 3300046663 Bacteria 1351
116 Ga0495623_0103915 3300046679 Bacteria 1728
117 Ga0495646_0027695 3300046680 Bacteria 3553
118 Ga0495613_0263131 3300046689 Bacteria 1201
119 Ga0495600_0062429 3300046809 Bacteria 2434
120 Ga0495604_0007192 3300047317 Bacteria 8817
121 Ga0495604_0140045 3300047317 Bacteria 1729
122 Ga0495674_0101807 3300047319 Bacteria 2443
123 Ga0495680_0001989 3300047322 Bacteria 21475
124 Ga0495684_0006644 3300047471 Bacteria 8969
125 Ga0495593_0155234 3300047673 Bacteria 1157
126 Ga0496100_0019878 3300048903 Bacteria 4016
127 Ga0496101_0032000 3300048904 Bacteria 3700
128 Ga0496102_0007980 3300048905 Bacteria 9045
129 Ga0496102_0105366 3300048905 Bacteria 2623
130 Ga0496104_0039976 3300048907 Bacteria 4394
131 Ga0496105_0029230 3300048908 Bacteria 4511
132 Ga0496106_0006089 3300048909 Bacteria 8924
133 Ga0496107_0006488 3300048910 Bacteria 8041
134 Ga0496107_0390172 3300048910 Bacteria 1036
135 Ga0496108_0001964 3300048911 Bacteria 16463
136 Ga0496108_0067789 3300048911 Bacteria 3010
137 Ga0496109_0004039 3300048912 Bacteria 12254
138 Ga0496109_0028340 3300048912 Bacteria 5008
139 Ga0496109_0377212 3300048912 Bacteria 1340
140 Ga0496109_0424339 3300048912 Bacteria 1256
141 Ga0496109_0458468 3300048912 Bacteria 1204
142 Ga0496110_0088082 3300048913 Bacteria 2772
143 Ga0496110_0176152 3300048913 Bacteria 1941
144 Ga0496110_0685742 3300048913 Bacteria 925
145 Ga0496111_0034458 3300048914 Bacteria 3615
146 Ga0496111_0088782 3300048914 Bacteria 2264
147 Ga0496111_0248471 3300048914 Bacteria 1320
148 Ga0496111_0315806 3300048914 Bacteria 1157
149 Ga0496112_0053609 3300048915 Bacteria 3961
150 Ga0496112_0167885 3300048915 Bacteria 2160
151 Ga0496112_0211417 3300048915 Bacteria 1897
152 Ga0496113_0042849 3300048916 Bacteria 3346
153 Ga0496113_0073456 3300048916 Bacteria 2606
154 Ga0496113_0095621 3300048916 Bacteria 2296
155 Ga0496115_0129330 3300048918 Bacteria 2081
156 Ga0496124_0270497 3300048927 Bacteria 1245
157 Ga0501031_0007670 3300049568 Bacteria 7023
158 Ga0501031_0059607 3300049568 Unclassified 2487
159 Ga0501031_0117155 3300049568 Bacteria 1740
160 Ga0501033_0032134 3300049570 Bacteria 3941
161 Ga0501034_0063625 3300049571 Bacteria 3703
162 Ga0501034_0145548 3300049571 Unclassified 2347
163 Ga0501036_0232863 3300049572 Bacteria 1545
164 Ga0501039_0043482 3300049575 Bacteria 3470
165 Ga0501039_0238669 3300049575 Bacteria 1429
166 Ga0501040_0032758 3300049576 Bacteria 3517
167 Ga0501040_0075808 3300049576 Bacteria 2325
168 Ga0501040_0083898 3300049576 Bacteria 2210
169 Ga0501040_0469811 3300049576 Bacteria 906
170 Ga0501041_0087354 3300049577 Bacteria 1924
171 Ga0501042_0048503 3300049578 Bacteria 3028
172 Ga0501042_0232033 3300049578 Bacteria 1331
173 Ga0501047_0301348 3300049581 Bacteria 1445
174 Ga0501048_0021197 3300049582 Bacteria 4758
175 Ga0501048_0069758 3300049582 Bacteria 2482
176 Ga0501068_0016278 3300049584 Bacteria 4286
177 Ga0501068_0096462 3300049584 Bacteria 1829
178 Ga0501070_0045572 3300049586 Bacteria 3647
179 Ga0501071_0053640 3300049587 Bacteria 2908
180 Ga0501071_0079795 3300049587 Bacteria 2393
181 Ga0501072_0010074 3300049588 Bacteria 7192
182 Ga0501072_0059481 3300049588 Bacteria 3013
183 Ga0501072_0095719 3300049588 Bacteria 2360
184 Ga0501072_0126970 3300049588 Bacteria 2032
185 Ga0501072_0269433 3300049588 Bacteria 1355
186 Ga0501072_0272035 3300049588 Bacteria 1348
187 Ga0501072_0320217 3300049588 Bacteria 1232
188 Ga0501073_0010820 3300049589 Bacteria 6681
189 Ga0501074_0055960 3300049590 Bacteria 2842
190 Ga0501074_0180256 3300049590 Bacteria 1507
191 Ga0501074_0326732 3300049590 Bacteria 1089
192 Ga0501075_0117900 3300049591 Unclassified 2018
193 Ga0501076_0026889 3300049592 Bacteria 4460
194 Ga0501077_0153566 3300049593 Bacteria 1461
195 Ga0501079_0012519 3300049741 Bacteria 6475
196 Ga0501079_0030533 3300049741 Bacteria 4141
197 Ga0501079_0096310 3300049741 Bacteria 2294
198 Ga0501079_0559021 3300049741 Bacteria 900
199 Ga0501081_0012708 3300049743 Bacteria 5537
200 Ga0501035_0187382 3300049822 Bacteria 1780
201 Ga0501044_0078989 3300049823 Bacteria 3335
202 Ga0501045_0037874 3300049824 Bacteria 3507
203 Ga0501045_0068169 3300049824 Bacteria 2613
204 Ga0501045_0149854 3300049824 Bacteria 1735
205 Ga0501045_0190018 3300049824 Bacteria 1531
206 nmdc:mga03n38_61333_c1 3300050490 Bacteria 1712
207 nmdc:mga00v17_182073_c1 3300050491 Bacteria 1356
208 nmdc:mga08y16_262815_c1 3300050511 Bacteria 1782
209 nmdc:mga08y16_547618_c1 3300050511 Bacteria 1171
210 Ga0495601_0044717 3300053077 Bacteria 2784
211 Ga0495595_0033801 3300053084 Bacteria 2309
212 Ga0495619_0008512 3300053085 Bacteria 6488
213 Ga0501084_0067648 3300054114 Bacteria 2990
214 Ga0501084_0134116 3300054114 Bacteria 2084
215 Ga0501082_0178419 3300060353 Bacteria 1847
216 Ga0501082_0203910 3300060353 Bacteria 1721
217 Ga0466962_0026936 3300061719 Unclassified 2760
218 Ga0530510_0020166 3300061734 Bacteria 4740
219 Ga0530510_0029702 3300061734 Bacteria 3924
220 Ga0530510_0247972 3300061734 Bacteria 1327
221 Ga0466967_0255304
222 Ga0070658_10005859
223 Ga0070683_100007498
224 Ga0070683_100054863
225 Ga0070683_100113384
226 Ga0070680_100019729
227 Ga0070682_100204766
228 Ga0070661_100041835
229 Ga0070671_100292927
230 Ga0070714_100279813
231 Ga0070713_100212644
232 Ga0070713_100244791
233 Ga0070710_10005816
234 Ga0070711_100005089
235 Ga0070711_100148372
236 Ga0070700_100345795
237 Ga0070678_100001519
238 Ga0070681_10048562
239 Ga0070684_100019476
240 Ga0068853_100106752
241 Ga0068856_100204226
242 Ga0068856_100324647
243 Ga0068866_10042840
244 Ga0081455_10083808
245 Ga0081538_10002487
246 Ga0081538_10019474
247 Ga0070717_10030606
248 Ga0070717_10165225
249 Ga0075365_10010422
250 Ga0075364_10068733
251 Ga0070712_100007827
252 Ga0070712_100115178
253 Ga0097621_100013582
254 Ga0075430_100149895
255 Ga0075431_100009364
256 Ga0075429_100010944
257 Ga0105240_10012558
258 Ga0111539_10367532
259 Ga0111539_10486424
260 Ga0105245_10101833
261 Ga0105243_10323874
262 Ga0105248_10490475
263 Ga0157370_10001705
264 Ga0157369_10323879
265 Ga0157372_10161284
266 Ga0157380_10310571
267 Ga0206353_11417191
268 Ga0207692_10017169
269 Ga0207693_10007149
270 Ga0207663_10051192
271 Ga0207657_10003888
272 Ga0207687_10225959
273 Ga0207664_10153414
274 Ga0207664_10219738
275 Ga0207661_10053596
276 Ga0207667_10166047
277 Ga0207640_10376891
278 Ga0207678_10037495
279 Ga0207702_10136603
280 Ga0207702_10258028
281 Ga0207428_10290641
282 Ga0265318_10001839
283 Ga0265338_10442118
284 Ga0265320_10018227
285 Ga0265316_10029481
286 Ga0265313_10022769
287 Ga0265314_10010847
288 Ga0307405_10091168
289 Ga0307413_10718667
290 Ga0307410_10091014
291 Ga0307406_10018914
292 Ga0307406_10089344
293 Ga0307406_10444268
294 Ga0307407_10413102
295 Ga0307409_100217044
296 Ga0307414_10034639
297 Ga0373953_0175342
298 Ga0373955_0113032
299 Ga0373924_0066532
300 Ga0373947_0389045
301 Ga0395900_0000456
302 Ga0395900_0574558
303 Ga0395898_0001237
304 Ga0395898_0370456
305 Ga0395901_0420102
306 Ga0436363_0256580
307 Ga0436363_1321212
308 Ga0466963_0005338
309 Ga0466963_0007226
310 Ga0466963_0013030
311 Ga0466963_0019904
312 Ga0466963_0117352
313 Ga0466963_0329389
314 Ga0466964_0175983
315 Ga0466970_0085816
316 Ga0466957_0019383
317 Ga0466960_0039418
318 Ga0466959_0161492
319 Ga0466958_0013528
320 Ga0466967_0048889
321 Ga0466967_0054331
322 Ga0466967_0066122
323 Ga0466967_0084358
324 Ga0466967_0322207
325 Ga0495629_0082990
326 Ga0495641_0113091
327 Ga0495664_0087391
328 Ga0495628_0036282
329 Ga0495652_0182652
330 Ga0495652_0328093
331 Ga0495640_0201412
332 Ga0495587_0023679
333 Ga0495667_0005056
334 Ga0495635_0008925
335 Ga0495635_0201247
336 Ga0495623_0103915
337 Ga0495646_0027695
338 Ga0495613_0263131
339 Ga0495600_0062429
340 Ga0495604_0007192
341 Ga0495604_0140045
342 Ga0495674_0101807
343 Ga0495680_0001989
344 Ga0495684_0006644
345 Ga0495593_0155234
346 Ga0496100_0019878
347 Ga0496101_0032000
348 Ga0496102_0007980
349 Ga0496102_0105366
350 Ga0496104_0039976
351 Ga0496105_0029230
352 Ga0496106_0006089
353 Ga0496107_0006488
354 Ga0496107_0390172
355 Ga0496108_0001964
356 Ga0496108_0067789
357 Ga0496109_0004039
358 Ga0496109_0028340
359 Ga0496109_0377212
360 Ga0496109_0424339
361 Ga0496109_0458468
362 Ga0496110_0088082
363 Ga0496110_0176152
364 Ga0496110_0685742
365 Ga0496111_0034458
366 Ga0496111_0088782
367 Ga0496111_0248471
368 Ga0496111_0315806
369 Ga0496112_0053609
370 Ga0496112_0167885
371 Ga0496112_0211417
372 Ga0496113_0042849
373 Ga0496113_0073456
374 Ga0496113_0095621
375 Ga0496115_0129330
376 Ga0496124_0270497
377 Ga0501031_0007670
378 Ga0501031_0059607
379 Ga0501031_0117155
380 Ga0501033_0032134
381 Ga0501034_0063625
382 Ga0501034_0145548
383 Ga0501036_0232863
384 Ga0501039_0043482
385 Ga0501039_0238669
386 Ga0501040_0032758
387 Ga0501040_0075808
388 Ga0501040_0083898
389 Ga0501040_0469811
390 Ga0501041_0087354
391 Ga0501042_0048503
392 Ga0501042_0232033
393 Ga0501047_0301348
394 Ga0501048_0021197
395 Ga0501048_0069758
396 Ga0501068_0016278
397 Ga0501068_0096462
398 Ga0501070_0045572
399 Ga0501071_0053640
400 Ga0501071_0079795
401 Ga0501072_0010074
402 Ga0501072_0059481
403 Ga0501072_0095719
404 Ga0501072_0126970
405 Ga0501072_0269433
406 Ga0501072_0272035
407 Ga0501072_0320217
408 Ga0501073_0010820
409 Ga0501074_0055960
410 Ga0501074_0180256
411 Ga0501074_0326732
412 Ga0501075_0117900
413 Ga0501076_0026889
414 Ga0501077_0153566
415 Ga0501079_0012519
416 Ga0501079_0030533
417 Ga0501079_0096310
418 Ga0501079_0559021
419 Ga0501081_0012708
420 Ga0501035_0187382
421 Ga0501044_0078989
422 Ga0501045_0037874
423 Ga0501045_0068169
424 Ga0501045_0149854
425 Ga0501045_0190018
426 nmdc:mga03n38_61333_c1
427 nmdc:mga00v17_182073_c1
428 nmdc:mga08y16_262815_c1
429 nmdc:mga08y16_547618_c1
430 Ga0495601_0044717
431 Ga0495595_0033801
432 Ga0495619_0008512
433 Ga0501084_0067648
434 Ga0501084_0134116
435 Ga0501082_0178419
436 Ga0501082_0203910
437 Ga0466962_0026936
438 Ga0530510_0020166
439 Ga0530510_0029702
440 Ga0530510_0247972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

33

271

0.78

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

35

277

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8949 8 108
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8907 8 108
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8895 8 108
4ns4-assembly1.cif.gz_A crystal structure of cold-active estarase from psychrobacter cryohalolentis k5t 0.8071 14 259
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.7981 8 108
ID Description Score Start End Superfamily
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.892 8 111 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8896 8 108 3.40.50.1820
af_Q9N4E0_18_170_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8659 8 113 3.40.50.1820
af_O53388_1_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8608 62 261 3.40.50.1820
af_A0A0R0EQP0_201_384_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8608 14 121 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7W1RAP2-F1-model_v4 Alpha/beta fold hydrolase 0.9907 3 261 GO:0016787
AF-A0A7Y6CVJ2-F1-model_v4 Alpha/beta fold hydrolase 0.9874 1 261 GO:0012505
GO:0016020
GO:0016787
AF-A0A7Y6CVJ2-F1-model_v4 Alpha/beta fold hydrolase 0.9725 1 261 GO:0012505
GO:0016020
GO:0016787
AF-A0A7W1RAP2-F1-model_v4 Alpha/beta fold hydrolase 0.9682 3 261 GO:0016787
AF-A0A535MKD6-F1-model_v4 Alpha/beta fold hydrolase 0.954 6 261 GO:0016787

Map