F332548

General Info

Members Datasets Scaffolds Average Seq Length
220 149 440 118

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0685594|Ga0451576_0685594_277_657
Length 126
Sequence MPAKLSTHVLDTAHGCPAEGMQIELWSLSGGKPKLLKKARTNADGRTDLPLLGPEEIKAGQYELVFCVGDYFAGKNPQNSRRGKETESTVRFLDRVPVRFGIADANASYHVPLLVSPWAYSTYRGS

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 97.73
Stem 0
Stem Tuber 0
Unclassified 29.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0685594 3300045051 Unclassified 1077
2 rootH2_10087354 3300003320 Bacteria 1549
3 Ga0070658_10100680 3300005327 Bacteria 2389
4 Ga0070676_10362561 3300005328 Bacteria 999
5 Ga0070683_100466806 3300005329 Bacteria 1205
6 Ga0070690_100460269 3300005330 Bacteria 945
7 Ga0070677_10062403 3300005333 Unclassified 1541
8 Ga0070680_101901412 3300005336 Unclassified 516
9 Ga0070660_100485442 3300005339 Bacteria 1027
10 Ga0070689_100024857 3300005340 Bacteria 4496
11 Ga0070689_100752981 3300005340 Unclassified 854
12 Ga0070691_10018557 3300005341 Bacteria 3207
13 Ga0070691_10511810 3300005341 Viruses 695
14 Ga0070692_10675228 3300005345 Unclassified 692
15 Ga0070668_100006128 3300005347 Bacteria 8916
16 Ga0070659_101057378 3300005366 Bacteria 714
17 Ga0070714_100006955 3300005435 Bacteria 8770
18 Ga0070713_102012383 3300005436 Unclassified 560
19 Ga0070701_10355828 3300005438 Bacteria 916
20 Ga0070711_100026769 3300005439 Unclassified 3782
21 Ga0070700_100585575 3300005441 Bacteria 872
22 Ga0070681_10165110 3300005458 Unclassified 2137
23 Ga0070681_10240240 3300005458 Bacteria 1725
24 Ga0070685_10458367 3300005466 Bacteria 894
25 Ga0070707_100738344 3300005468 Bacteria 948
26 Ga0070699_100504354 3300005518 Unclassified 1099
27 Ga0070684_100034904 3300005535 Bacteria 4303
28 Ga0070684_101091081 3300005535 Bacteria 750
29 Ga0070684_102191014 3300005535 Bacteria 521
30 Ga0070686_100415182 3300005544 Bacteria 1027
31 Ga0070695_100239567 3300005545 Unclassified 1315
32 Ga0070695_101686950 3300005545 Unclassified 530
33 Ga0068855_100012782 3300005563 Bacteria 10127
34 Ga0068855_100065540 3300005563 Bacteria 4235
35 Ga0068855_100080395 3300005563 Bacteria 3779
36 Ga0068855_100150374 3300005563 Bacteria 2648
37 Ga0068855_100603990 3300005563 Bacteria 1183
38 Ga0068855_101306172 3300005563 Bacteria 751
39 Ga0068854_101390099 3300005578 Bacteria 634
40 Ga0068856_100001463 3300005614 Bacteria 24731
41 Ga0068856_100070238 3300005614 Bacteria 3464
42 Ga0068856_101251849 3300005614 Bacteria 758
43 Ga0068859_100798973 3300005617 Unclassified 1031
44 Ga0068864_100030812 3300005618 Bacteria 4548
45 Ga0068866_10388061 3300005718 Unclassified 897
46 Ga0068861_100102037 3300005719 Bacteria 2283
47 Ga0068863_100173475 3300005841 Bacteria 2069
48 Ga0068862_100939632 3300005844 Bacteria 852
49 Ga0081455_10133227 3300005937 Bacteria 1940
50 Ga0081455_10510397 3300005937 Bacteria 805
51 Ga0070717_10694976 3300006028 Unclassified 924
52 Ga0070712_100091667 3300006175 Bacteria 2227
53 Ga0097621_100756063 3300006237 Unclassified 898
54 Ga0068871_100946678 3300006358 Bacteria 800
55 Ga0075434_100410504 3300006871 Unclassified 1375
56 Ga0075434_100423630 3300006871 Bacteria 1352
57 Ga0075434_101122881 3300006871 Bacteria 799
58 Ga0097620_100799053 3300006931 Unclassified 1031
59 Ga0075435_101837063 3300007076 Bacteria 532
60 Ga0105240_10057351 3300009093 Bacteria 4866
61 Ga0105240_10322339 3300009093 Unclassified 1761
62 Ga0105240_12400229 3300009093 Bacteria 546
63 Ga0111539_10814139 3300009094 Bacteria 1087
64 Ga0105245_10109658 3300009098 Bacteria 2565
65 Ga0114129_10081719 3300009147 Bacteria 4491
66 Ga0105242_10061522 3300009176 Bacteria 3088
67 Ga0105242_11186871 3300009176 Bacteria 782
68 Ga0105242_11412217 3300009176 Unclassified 724
69 Ga0105248_11238191 3300009177 Bacteria 844
70 Ga0105248_13100728 3300009177 Bacteria 529
71 Ga0105237_11410967 3300009545 Unclassified 703
72 Ga0105238_10025003 3300009551 Bacteria 6088
73 Ga0105238_10044529 3300009551 Bacteria 4486
74 Ga0105249_10004082 3300009553 Bacteria 12601
75 Ga0099796_10313747 3300010159 Unclassified 667
76 Ga0105239_10341477 3300010375 Bacteria 1690
77 Ga0157370_10342171 3300013104 Bacteria 1379
78 Ga0157374_10716216 3300013296 Bacteria 1014
79 Ga0157378_11279414 3300013297 Unclassified 774
80 Ga0157372_13184881 3300013307 Bacteria 523
81 Ga0163163_10057395 3300014325 Bacteria 3849
82 Ga0163161_10390288 3300017792 Bacteria 1114
83 Ga0213871_10210847 3300021441 Bacteria 608
84 Ga0207682_10062250 3300025893 Bacteria 1564
85 Ga0207688_10069501 3300025901 Bacteria 1996
86 Ga0207645_10439427 3300025907 Bacteria 880
87 Ga0207705_10150453 3300025909 Bacteria 1744
88 Ga0207707_10064914 3300025912 Bacteria 3179
89 Ga0207707_10208993 3300025912 Bacteria 1701
90 Ga0207707_10686063 3300025912 Bacteria 861
91 Ga0207695_10140382 3300025913 Unclassified 2365
92 Ga0207695_10184736 3300025913 Bacteria 2004
93 Ga0207663_11437663 3300025916 Bacteria 555
94 Ga0207660_10761690 3300025917 Bacteria 790
95 Ga0207660_11298616 3300025917 Unclassified 591
96 Ga0207662_10221604 3300025918 Unclassified 1232
97 Ga0207657_10268026 3300025919 Bacteria 1358
98 Ga0207652_10712281 3300025921 Bacteria 895
99 Ga0207694_10057446 3300025924 Bacteria 3025
100 Ga0207694_10065535 3300025924 Unclassified 2832
101 Ga0207687_10016637 3300025927 Bacteria 4832
102 Ga0207700_11424948 3300025928 Bacteria 616
103 Ga0207664_10005416 3300025929 Bacteria 8716
104 Ga0207690_10842660 3300025932 Bacteria 759
105 Ga0207706_10010596 3300025933 Bacteria 8419
106 Ga0207686_10172749 3300025934 Unclassified 1526
107 Ga0207670_10162271 3300025936 Unclassified 1669
108 Ga0207670_10330344 3300025936 Unclassified 1202
109 Ga0207667_10006409 3300025949 Bacteria 14256
110 Ga0207667_10089653 3300025949 Bacteria 3178
111 Ga0207667_10140502 3300025949 Bacteria 2486
112 Ga0207712_10040941 3300025961 Bacteria 3182
113 Ga0207668_10311254 3300025972 Unclassified 1303
114 Ga0207677_12045946 3300026023 Unclassified 532
115 Ga0207708_10053078 3300026075 Bacteria 3088
116 Ga0207702_10002750 3300026078 Bacteria 16457
117 Ga0207702_10017866 3300026078 Bacteria 5871
118 Ga0207641_10126833 3300026088 Bacteria 2286
119 Ga0207676_10062314 3300026095 Bacteria 2958
120 Ga0207674_10637965 3300026116 Archaea 1029
121 Ga0207675_100004117 3300026118 Bacteria 14075
122 Ga0268265_10662575 3300028380 Bacteria 1004
123 Ga0265337_1000059 3300028556 Bacteria 49839
124 Ga0265337_1002047 3300028556 Bacteria 9546
125 Ga0265326_10003347 3300028558 Bacteria 5272
126 Ga0265326_10181142 3300028558 Unclassified 604
127 Ga0265319_1047326 3300028563 Unclassified 1431
128 Ga0265334_10003805 3300028573 Bacteria 6822
129 Ga0265334_10158675 3300028573 Unclassified 796
130 Ga0265336_10012180 3300028666 Unclassified 2897
131 Ga0265336_10068208 3300028666 Bacteria 1064
132 Ga0265338_10000101 3300028800 Bacteria 159323
133 Ga0265338_10000108 3300028800 Bacteria 152898
134 Ga0265338_10001836 3300028800 Bacteria 33314
135 Ga0265338_10020031 3300028800 Bacteria 7056
136 Ga0265338_10060511 3300028800 Bacteria 3327
137 Ga0265338_10120633 3300028800 Bacteria 2091
138 Ga0265338_10134666 3300028800 Bacteria 1945
139 Ga0265338_10153150 3300028800 Bacteria 1789
140 Ga0265338_10813952 3300028800 Unclassified 639
141 Ga0265338_10982652 3300028800 Bacteria 572
142 Ga0265324_10000962 3300029957 Bacteria 17918
143 Ga0265324_10102145 3300029957 Unclassified 974
144 Ga0307511_10345184 3300030521 Bacteria 643
145 Ga0265330_10397695 3300031235 Bacteria 583
146 Ga0265332_10009995 3300031238 Unclassified 4226
147 Ga0265328_10435282 3300031239 Bacteria 517
148 Ga0265320_10000273 3300031240 Bacteria 42448
149 Ga0265320_10000519 3300031240 Bacteria 29905
150 Ga0265320_10069869 3300031240 Bacteria 1657
151 Ga0265320_10085407 3300031240 Bacteria 1469
152 Ga0265327_10013172 3300031251 Bacteria 5511
153 Ga0265327_10156112 3300031251 Bacteria 1057
154 Ga0265316_10229262 3300031344 Bacteria 1368
155 Ga0265316_10261199 3300031344 Unclassified 1270
156 Ga0265314_10054860 3300031711 Bacteria 2755
157 Ga0265314_10171194 3300031711 Bacteria 1311
158 Ga0265314_10724702 3300031711 Unclassified 501
159 Ga0265342_10104248 3300031712 Unclassified 1612
160 Ga0373948_0054237 3300034817 Bacteria 867
161 Ga0373931_0113889 3300035691 Unclassified 1538
162 Ga0373927_0002299 3300035695 Bacteria 13971
163 Ga0373927_0477283 3300035695 Bacteria 824
164 Ga0373937_0239506 3300036401 Unclassified 1709
165 Ga0373937_1673453 3300036401 Bacteria 583
166 Ga0373925_0006441 3300037068 Bacteria 8639
167 Ga0373925_0515650 3300037068 Unclassified 982
168 Ga0395901_0636662 3300038443 Bacteria 1071
169 Ga0395901_1052597 3300038443 Bacteria 787
170 Ga0436360_0373481 3300039438 Bacteria 1050
171 Ga0436360_0473522 3300039438 Bacteria 594
172 Ga0466968_0442459 3300044735 Bacteria 642
173 Ga0451576_0080052 3300045051 Unclassified 3399
174 Ga0451576_0255969 3300045051 Unclassified 1830
175 Ga0451576_0268077 3300045051 Bacteria 1785
176 Ga0451576_0378215 3300045051 Bacteria 1484
177 Ga0451576_0521021 3300045051 Bacteria 1249
178 Ga0451576_1344433 3300045051 Unclassified 744
179 Ga0495603_0462211 3300046455 Unclassified 727
180 Ga0495651_0548646 3300046462 Unclassified 735
181 Ga0495580_0366404 3300046472 Bacteria 975
182 Ga0495605_0136310 3300046474 Bacteria 1104
183 Ga0495639_0332132 3300046475 Unclassified 761
184 Ga0495608_0610116 3300046511 Unclassified 654
185 Ga0495618_0819777 3300046514 Unclassified 541
186 Ga0495628_0345191 3300046516 Bacteria 1095
187 Ga0495630_0002212 3300046517 Bacteria 13545
188 Ga0495640_0053420 3300046533 Bacteria 2770
189 Ga0495640_0406884 3300046533 Unclassified 835
190 Ga0495640_0561368 3300046533 Unclassified 691
191 Ga0495586_0032461 3300046535 Bacteria 2799
192 Ga0495586_0060532 3300046535 Bacteria 2059
193 Ga0495645_0227054 3300046543 Bacteria 1253
194 Ga0495667_0024032 3300046559 Bacteria 4104
195 Ga0495667_0047736 3300046559 Bacteria 2828
196 Ga0495668_0722815 3300046616 Unclassified 551
197 Ga0495657_0762561 3300046675 Unclassified 554
198 Ga0495658_0135134 3300046683 Bacteria 1504
199 Ga0495658_0422292 3300046683 Bacteria 851
200 Ga0495669_0382192 3300046684 Bacteria 682
201 Ga0495624_0182909 3300046690 Unclassified 1277
202 Ga0495624_0723713 3300046690 Unclassified 590
203 Ga0495600_0463391 3300046809 Unclassified 782
204 Ga0495604_0362828 3300047317 Unclassified 960
205 Ga0495674_0631734 3300047319 Bacteria 846
206 Ga0495676_0049566 3300047321 Bacteria 3375
207 Ga0495680_0253539 3300047322 Bacteria 1246
208 Ga0495675_0759500 3300047444 Unclassified 539
209 Ga0495684_0064146 3300047471 Bacteria 2792
210 Ga0495684_0868399 3300047471 Unclassified 584
211 Ga0496104_1347492 3300048907 Bacteria 617
212 Ga0496112_0669544 3300048915 Bacteria 967
213 Ga0496115_0003707 3300048918 Bacteria 10994
214 Ga0501033_0132259 3300049570 Bacteria 1807
215 Ga0501034_0920982 3300049571 Bacteria 761
216 nmdc:mga05p37_456039_c1 3300050507 Bacteria 1478
217 nmdc:mga0n895_2033984_c1 3300050512 Bacteria 532
218 nmdc:mga0n895_394395_c1 3300050512 Unclassified 1400
219 Ga0466962_0712974 3300061719 Unclassified 515
220 3001892868 3001892409 Bacteria 6328293
221 Ga0451576_0685594
222 rootH2_10087354
223 Ga0070658_10100680
224 Ga0070676_10362561
225 Ga0070683_100466806
226 Ga0070690_100460269
227 Ga0070677_10062403
228 Ga0070680_101901412
229 Ga0070660_100485442
230 Ga0070689_100024857
231 Ga0070689_100752981
232 Ga0070691_10018557
233 Ga0070691_10511810
234 Ga0070692_10675228
235 Ga0070668_100006128
236 Ga0070659_101057378
237 Ga0070714_100006955
238 Ga0070713_102012383
239 Ga0070701_10355828
240 Ga0070711_100026769
241 Ga0070700_100585575
242 Ga0070681_10165110
243 Ga0070681_10240240
244 Ga0070685_10458367
245 Ga0070707_100738344
246 Ga0070699_100504354
247 Ga0070684_100034904
248 Ga0070684_101091081
249 Ga0070684_102191014
250 Ga0070686_100415182
251 Ga0070695_100239567
252 Ga0070695_101686950
253 Ga0068855_100012782
254 Ga0068855_100065540
255 Ga0068855_100080395
256 Ga0068855_100150374
257 Ga0068855_100603990
258 Ga0068855_101306172
259 Ga0068854_101390099
260 Ga0068856_100001463
261 Ga0068856_100070238
262 Ga0068856_101251849
263 Ga0068859_100798973
264 Ga0068864_100030812
265 Ga0068866_10388061
266 Ga0068861_100102037
267 Ga0068863_100173475
268 Ga0068862_100939632
269 Ga0081455_10133227
270 Ga0081455_10510397
271 Ga0070717_10694976
272 Ga0070712_100091667
273 Ga0097621_100756063
274 Ga0068871_100946678
275 Ga0075434_100410504
276 Ga0075434_100423630
277 Ga0075434_101122881
278 Ga0097620_100799053
279 Ga0075435_101837063
280 Ga0105240_10057351
281 Ga0105240_10322339
282 Ga0105240_12400229
283 Ga0111539_10814139
284 Ga0105245_10109658
285 Ga0114129_10081719
286 Ga0105242_10061522
287 Ga0105242_11186871
288 Ga0105242_11412217
289 Ga0105248_11238191
290 Ga0105248_13100728
291 Ga0105237_11410967
292 Ga0105238_10025003
293 Ga0105238_10044529
294 Ga0105249_10004082
295 Ga0099796_10313747
296 Ga0105239_10341477
297 Ga0157370_10342171
298 Ga0157374_10716216
299 Ga0157378_11279414
300 Ga0157372_13184881
301 Ga0163163_10057395
302 Ga0163161_10390288
303 Ga0213871_10210847
304 Ga0207682_10062250
305 Ga0207688_10069501
306 Ga0207645_10439427
307 Ga0207705_10150453
308 Ga0207707_10064914
309 Ga0207707_10208993
310 Ga0207707_10686063
311 Ga0207695_10140382
312 Ga0207695_10184736
313 Ga0207663_11437663
314 Ga0207660_10761690
315 Ga0207660_11298616
316 Ga0207662_10221604
317 Ga0207657_10268026
318 Ga0207652_10712281
319 Ga0207694_10057446
320 Ga0207694_10065535
321 Ga0207687_10016637
322 Ga0207700_11424948
323 Ga0207664_10005416
324 Ga0207690_10842660
325 Ga0207706_10010596
326 Ga0207686_10172749
327 Ga0207670_10162271
328 Ga0207670_10330344
329 Ga0207667_10006409
330 Ga0207667_10089653
331 Ga0207667_10140502
332 Ga0207712_10040941
333 Ga0207668_10311254
334 Ga0207677_12045946
335 Ga0207708_10053078
336 Ga0207702_10002750
337 Ga0207702_10017866
338 Ga0207641_10126833
339 Ga0207676_10062314
340 Ga0207674_10637965
341 Ga0207675_100004117
342 Ga0268265_10662575
343 Ga0265337_1000059
344 Ga0265337_1002047
345 Ga0265326_10003347
346 Ga0265326_10181142
347 Ga0265319_1047326
348 Ga0265334_10003805
349 Ga0265334_10158675
350 Ga0265336_10012180
351 Ga0265336_10068208
352 Ga0265338_10000101
353 Ga0265338_10000108
354 Ga0265338_10001836
355 Ga0265338_10020031
356 Ga0265338_10060511
357 Ga0265338_10120633
358 Ga0265338_10134666
359 Ga0265338_10153150
360 Ga0265338_10813952
361 Ga0265338_10982652
362 Ga0265324_10000962
363 Ga0265324_10102145
364 Ga0307511_10345184
365 Ga0265330_10397695
366 Ga0265332_10009995
367 Ga0265328_10435282
368 Ga0265320_10000273
369 Ga0265320_10000519
370 Ga0265320_10069869
371 Ga0265320_10085407
372 Ga0265327_10013172
373 Ga0265327_10156112
374 Ga0265316_10229262
375 Ga0265316_10261199
376 Ga0265314_10054860
377 Ga0265314_10171194
378 Ga0265314_10724702
379 Ga0265342_10104248
380 Ga0373948_0054237
381 Ga0373931_0113889
382 Ga0373927_0002299
383 Ga0373927_0477283
384 Ga0373937_0239506
385 Ga0373937_1673453
386 Ga0373925_0006441
387 Ga0373925_0515650
388 Ga0395901_0636662
389 Ga0395901_1052597
390 Ga0436360_0373481
391 Ga0436360_0473522
392 Ga0466968_0442459
393 Ga0451576_0080052
394 Ga0451576_0255969
395 Ga0451576_0268077
396 Ga0451576_0378215
397 Ga0451576_0521021
398 Ga0451576_1344433
399 Ga0495603_0462211
400 Ga0495651_0548646
401 Ga0495580_0366404
402 Ga0495605_0136310
403 Ga0495639_0332132
404 Ga0495608_0610116
405 Ga0495618_0819777
406 Ga0495628_0345191
407 Ga0495630_0002212
408 Ga0495640_0053420
409 Ga0495640_0406884
410 Ga0495640_0561368
411 Ga0495586_0032461
412 Ga0495586_0060532
413 Ga0495645_0227054
414 Ga0495667_0024032
415 Ga0495667_0047736
416 Ga0495668_0722815
417 Ga0495657_0762561
418 Ga0495658_0135134
419 Ga0495658_0422292
420 Ga0495669_0382192
421 Ga0495624_0182909
422 Ga0495624_0723713
423 Ga0495600_0463391
424 Ga0495604_0362828
425 Ga0495674_0631734
426 Ga0495676_0049566
427 Ga0495680_0253539
428 Ga0495675_0759500
429 Ga0495684_0064146
430 Ga0495684_0868399
431 Ga0496104_1347492
432 Ga0496112_0669544
433 Ga0496115_0003707
434 Ga0501033_0132259
435 Ga0501034_0920982
436 nmdc:mga05p37_456039_c1
437 nmdc:mga0n895_2033984_c1
438 nmdc:mga0n895_394395_c1
439 Ga0466962_0712974
440 3001892868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00576

Transthyretin

HIUase/Transthyretin family

5

125

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q14-assembly1.cif.gz_B crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis 0.955 3 118
2h0e-assembly1.cif.gz_A crystal structure of pucm in the absence of substrate 0.9519 3 118
2h0e-assembly2.cif.gz_B crystal structure of pucm in the absence of substrate 0.9426 3 118
2h0e-assembly1.cif.gz_A crystal structure of pucm in the absence of substrate 0.9356 3 118
3glz-assembly1.cif.gz_B human transthyretin (ttr) complexed with(e)-3-(2-(trifluoromethyl)benzylideneaminooxy)propanoic acid (inhibitor 11) 0.9281 4 118
ID Description Score Start End Superfamily
4q14B00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9551 3 118 2.60.40.180
2h0jA00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9448 4 118 2.60.40.180
2h0jA00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9281 4 118 2.60.40.180
3iwvA00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9263 4 118 2.60.40.180
2gpzC00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9155 4 118 2.60.40.180
ID Description Score Start End GO Terms
AF-A0A382QT53-F1-model_v4 Transthyretin/hydroxyisourate hydrolase domain-containing protein 0.9833 4 66 GO:0006144
AF-W7VRP9-F1-model_v4 hydroxyisourate hydrolase (EC 3.5.2.17) 0.9725 3 110 GO:0006144
GO:0016020
GO:0033971
AF-A0A849G5Y7-F1-model_v4 5-hydroxyisourate hydrolase 0.97 1 71 GO:0006144
GO:0016787
AF-A0A526YPS3-F1-model_v4 5-hydroxyisourate hydrolase 0.9654 2 60 GO:0006144
GO:0016787
AF-A0A382FNR7-F1-model_v4 hydroxyisourate hydrolase (EC 3.5.2.17) 0.964 1 103 GO:0006144
GO:0033971

Map