F332535

General Info

Members Datasets Scaffolds Average Seq Length
220 128 440 151

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0117143|Ga0466966_0117143_186_698
Length 170
Sequence MVRQPKVALSEKVATALSQHFFPRDEYFMRLALREAASALDHDDVPIGAVIVKDGEVIATGHNERELRADPTAHAELIALREAARALGSWRVLDSVMYVTLEPCAMCAGAIVLARVPRVVFGAWDPKAGAAGSVLDVLDTPQLNHRPQVQAGLLAEESAEMLRDFFASRR

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
51 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
52 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
59 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
60 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
61 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
62 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
80 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
84 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
85 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
86 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
87 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
90 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
124 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 3.64
Rhizosphere 83.18
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0117143 3300044684 Bacteria 1639
2 Ga0070683_100492714 3300005329 Unclassified 1170
3 Ga0070677_10000007 3300005333 Bacteria 74721
4 Ga0068868_100780495 3300005338 Bacteria 860
5 Ga0070671_101265754 3300005355 Bacteria 650
6 Ga0070674_100000026 3300005356 Bacteria 77168
7 Ga0070713_100693343 3300005436 Bacteria 972
8 Ga0070710_10192605 3300005437 Bacteria 1283
9 Ga0070694_100116375 3300005444 Bacteria 1912
10 Ga0070697_100991294 3300005536 Bacteria 747
11 Ga0070686_100584333 3300005544 Bacteria 878
12 Ga0070695_100172437 3300005545 Bacteria 1527
13 Ga0070695_100186542 3300005545 Bacteria 1473
14 Ga0070696_100068906 3300005546 Bacteria 2485
15 Ga0068866_10000006 3300005718 Bacteria 176129
16 Ga0068862_100519253 3300005844 Bacteria 1133
17 Ga0075365_10011304 3300006038 Bacteria 5244
18 Ga0070716_100430000 3300006173 Bacteria 957
19 Ga0075428_100016800 3300006844 Bacteria 8081
20 Ga0075428_100995870 3300006844 Unclassified 887
21 Ga0075430_100019528 3300006846 Bacteria 5764
22 Ga0075431_100360177 3300006847 Bacteria 1461
23 Ga0075433_10082241 3300006852 Bacteria 2840
24 Ga0075434_100031892 3300006871 Bacteria 5196
25 Ga0068865_101061395 3300006881 Bacteria 712
26 Ga0111539_10029043 3300009094 Bacteria 6742
27 Ga0105245_10088234 3300009098 Bacteria 2848
28 Ga0114129_10032139 3300009147 Bacteria 7418
29 Ga0114129_10082527 3300009147 Bacteria 4466
30 Ga0114129_10131528 3300009147 Bacteria 3436
31 Ga0114129_11435343 3300009147 Bacteria 850
32 Ga0105243_11352105 3300009148 Bacteria 731
33 Ga0105249_10828241 3300009553 Bacteria 990
34 Ga0105239_10136406 3300010375 Bacteria 2732
35 Ga0157374_10006538 3300013296 Bacteria 9899
36 Ga0163162_10265167 3300013306 Bacteria 1849
37 Ga0163163_10329697 3300014325 Bacteria 1581
38 Ga0157376_11344780 3300014969 Bacteria 745
39 Ga0213873_10048029 3300021358 Bacteria 1121
40 Ga0213874_10001037 3300021377 Bacteria 5680
41 Ga0213874_10234011 3300021377 Bacteria 672
42 Ga0213876_10252365 3300021384 Bacteria 937
43 Ga0213875_10004456 3300021388 Bacteria 7681
44 Ga0213875_10013011 3300021388 Bacteria 4096
45 Ga0213875_10036198 3300021388 Bacteria 2328
46 Ga0213875_10165614 3300021388 Bacteria 1037
47 Ga0207642_10000001 3300025899 Bacteria 714030
48 Ga0207642_10000003 3300025899 Bacteria 650651
49 Ga0207642_10000004 3300025899 Bacteria 407822
50 Ga0207664_10147535 3300025929 Bacteria 1996
51 Ga0207664_10753959 3300025929 Bacteria 875
52 Ga0207644_10932181 3300025931 Bacteria 728
53 Ga0207709_10791398 3300025935 Bacteria 765
54 Ga0207669_10000041 3300025937 Bacteria 67085
55 Ga0207704_10691506 3300025938 Bacteria 844
56 Ga0207639_10001070 3300026041 Bacteria 18591
57 Ga0207428_10083048 3300027907 Bacteria 2499
58 Ga0265337_1003357 3300028556 Bacteria 6966
59 Ga0307406_10398403 3300031901 Bacteria 1090
60 Ga0307409_100300574 3300031995 Bacteria 1493
61 Ga0307416_100547666 3300032002 Bacteria 1230
62 Ga0373933_0586786 3300035724 Bacteria 732
63 Ga0373937_1846137 3300036401 Bacteria 551
64 Ga0395899_0030240 3300037312 Bacteria 4074
65 Ga0395899_0328789 3300037312 Bacteria 1028
66 Ga0395899_0428733 3300037312 Bacteria 870
67 Ga0395899_0760935 3300037312 Bacteria 602
68 Ga0395900_0016352 3300037418 Bacteria 7561
69 Ga0395898_0015519 3300037466 Bacteria 7811
70 Ga0395898_0102667 3300037466 Bacteria 2745
71 Ga0395898_0108560 3300037466 Bacteria 2661
72 Ga0395905_0005342 3300037471 Bacteria 13126
73 Ga0395905_0315945 3300037471 Bacteria 1451
74 Ga0436364_0056314 3300037853 Bacteria 1075
75 Ga0436364_0177769 3300037853 Bacteria 2003
76 Ga0436364_0227018 3300037853 Bacteria 11156
77 Ga0436364_0332773 3300037853 Bacteria 572
78 Ga0436364_0353125 3300037853 Bacteria 2140
79 Ga0436364_0362141 3300037853 Bacteria 1470
80 Ga0436364_0520267 3300037853 Bacteria 922
81 Ga0436364_0543778 3300037853 Bacteria 938
82 Ga0436364_0579394 3300037853 Bacteria 999
83 Ga0395901_0001986 3300038443 Bacteria 21041
84 Ga0395901_0029626 3300038443 Bacteria 5636
85 Ga0436365_0112112 3300039437 Bacteria 610
86 Ga0436365_0219317 3300039437 Bacteria 3634
87 Ga0436365_0266643 3300039437 Bacteria 26024
88 Ga0436365_0521800 3300039437 Bacteria 1182
89 Ga0436365_1915911 3300039437 Bacteria 11767
90 Ga0436360_0494816 3300039438 Bacteria 590
91 Ga0436361_0703206 3300039447 Bacteria 629
92 Ga0436361_0968857 3300039447 Bacteria 576
93 Ga0436363_0152724 3300039450 Bacteria 1943
94 Ga0436363_0166336 3300039450 Bacteria 846
95 Ga0436363_0200076 3300039450 Bacteria 789
96 Ga0436363_0436839 3300039450 Bacteria 737
97 Ga0436363_0578398 3300039450 Bacteria 736
98 Ga0436363_1667785 3300039450 Bacteria 997
99 Ga0436362_0471073 3300039453 Bacteria 2301
100 Ga0436362_0597238 3300039453 Bacteria 594
101 Ga0436362_0600234 3300039453 Bacteria 631
102 Ga0466969_0047267 3300044656 Bacteria 2131
103 Ga0466969_0330996 3300044656 Bacteria 689
104 Ga0466965_0285948 3300044683 Bacteria 892
105 Ga0466965_0904175 3300044683 Bacteria 515
106 Ga0466966_0228036 3300044684 Bacteria 1124
107 Ga0466961_0017357 3300044693 Bacteria 4623
108 Ga0466961_0020095 3300044693 Bacteria 4298
109 Ga0466961_0024045 3300044693 Bacteria 3920
110 Ga0466961_0664080 3300044693 Bacteria 625
111 Ga0466963_0000025 3300044694 Bacteria 51171
112 Ga0466963_0000961 3300044694 Bacteria 14791
113 Ga0466963_0311139 3300044694 Bacteria 1108
114 Ga0466963_0384932 3300044694 Bacteria 989
115 Ga0466963_0548677 3300044694 Bacteria 816
116 Ga0466964_0276537 3300044706 Bacteria 838
117 Ga0466971_0014232 3300044719 Bacteria 3498
118 Ga0466971_0037709 3300044719 Bacteria 2167
119 Ga0466970_0039418 3300044765 Bacteria 2507
120 Ga0466970_0523966 3300044765 Bacteria 684
121 Ga0466957_0086251 3300044842 Bacteria 1962
122 Ga0466957_0429268 3300044842 Bacteria 908
123 Ga0466959_0000356 3300045049 Bacteria 26996
124 Ga0466959_0040512 3300045049 Bacteria 3441
125 Ga0466959_0069806 3300045049 Bacteria 2545
126 Ga0466959_0105787 3300045049 Bacteria 2012
127 Ga0466959_0113244 3300045049 Bacteria 1934
128 Ga0466959_0263006 3300045049 Bacteria 1187
129 Ga0466959_0536273 3300045049 Bacteria 790
130 Ga0466959_0552518 3300045049 Bacteria 776
131 Ga0466959_0608099 3300045049 Bacteria 735
132 Ga0466959_0673258 3300045049 Bacteria 694
133 Ga0466959_0732563 3300045049 Bacteria 662
134 Ga0466959_0891691 3300045049 Bacteria 593
135 Ga0466958_0000216 3300045836 Bacteria 21669
136 Ga0466958_0036597 3300045836 Bacteria 2939
137 Ga0466958_0055459 3300045836 Bacteria 2405
138 Ga0466958_0063396 3300045836 Bacteria 2254
139 Ga0466958_0078540 3300045836 Bacteria 2028
140 Ga0466958_0130481 3300045836 Bacteria 1578
141 Ga0466958_0616499 3300045836 Bacteria 706
142 Ga0466958_0616760 3300045836 Bacteria 706
143 Ga0466958_0622308 3300045836 Bacteria 702
144 Ga0466958_0894169 3300045836 Bacteria 579
145 Ga0466958_0906460 3300045836 Bacteria 575
146 Ga0466967_0115321 3300045976 Bacteria 2474
147 Ga0466967_0358421 3300045976 Bacteria 1413
148 Ga0466967_1378866 3300045976 Bacteria 702
149 Ga0495641_0072923 3300046461 Bacteria 1540
150 Ga0495651_0386075 3300046462 Bacteria 917
151 Ga0495664_0180987 3300046477 Bacteria 1278
152 Ga0495608_0812744 3300046511 Bacteria 551
153 Ga0495628_0330888 3300046516 Bacteria 1123
154 Ga0495642_0191229 3300046528 Bacteria 891
155 Ga0495645_0110390 3300046543 Bacteria 1947
156 Ga0495668_0604216 3300046616 Bacteria 606
157 Ga0495657_0273861 3300046675 Bacteria 1011
158 Ga0495623_0146836 3300046679 Bacteria 1398
159 Ga0495647_0000010 3300046681 Bacteria 94696
160 Ga0495669_0000545 3300046684 Bacteria 16848
161 Ga0495624_0000049 3300046690 Bacteria 75485
162 Ga0495604_0695896 3300047317 Bacteria 646
163 Ga0495680_0000364 3300047322 Bacteria 50773
164 Ga0495679_007923 3300047446 Bacteria 4372
165 Ga0495602_0439139 3300048088 Bacteria 923
166 Ga0496102_0450956 3300048905 Bacteria 1207
167 Ga0496105_0592347 3300048908 Bacteria 861
168 Ga0496109_0052018 3300048912 Bacteria 3732
169 Ga0496110_0029249 3300048913 Bacteria 4740
170 Ga0496112_0381529 3300048915 Bacteria 1350
171 Ga0496114_0095365 3300048917 Bacteria 2532
172 Ga0496114_0117714 3300048917 Bacteria 2282
173 Ga0496115_0435100 3300048918 Bacteria 1061
174 Ga0501033_0410315 3300049570 Bacteria 944
175 Ga0501039_1194347 3300049575 Bacteria 588
176 Ga0501040_0071362 3300049576 Bacteria 2397
177 Ga0501041_0185694 3300049577 Bacteria 1302
178 Ga0501042_0074706 3300049578 Bacteria 2426
179 Ga0501046_0492288 3300049580 Bacteria 879
180 Ga0501048_0018427 3300049582 Bacteria 5135
181 Ga0501048_0823449 3300049582 Bacteria 667
182 Ga0501071_0315581 3300049587 Bacteria 1186
183 Ga0501072_0036371 3300049588 Bacteria 3860
184 Ga0501072_0079623 3300049588 Bacteria 2595
185 Ga0501072_0560959 3300049588 Bacteria 901
186 Ga0501073_0343108 3300049589 Bacteria 1031
187 Ga0501074_0624372 3300049590 Bacteria 762
188 Ga0501075_0039277 3300049591 Bacteria 3543
189 Ga0501075_0284246 3300049591 Bacteria 1260
190 Ga0501076_0320973 3300049592 Bacteria 1270
191 Ga0501076_1554996 3300049592 Bacteria 543
192 Ga0501079_0316162 3300049741 Bacteria 1222
193 Ga0501080_1882820 3300049742 Bacteria 501
194 Ga0501081_0320861 3300049743 Bacteria 1138
195 Ga0501045_0153168 3300049824 Bacteria 1715
196 nmdc:mga0yw44_151938_c1 3300050492 Bacteria 1511
197 nmdc:mga05p37_157869_c1 3300050507 Bacteria 2771
198 nmdc:mga05p37_66778_c1 3300050507 Bacteria 4424
199 nmdc:mga05p37_676755_c1 3300050507 Bacteria 1151
200 nmdc:mga05p37_877884_c1 3300050507 Bacteria 970
201 nmdc:mga0qj67_57870_c1 3300050509 Bacteria 3073
202 nmdc:mga06r32_106369_c1 3300050510 Bacteria 2756
203 nmdc:mga06r32_590114_c1 3300050510 Bacteria 1083
204 nmdc:mga08y16_32725_c1 3300050511 Bacteria 5466
205 nmdc:mga0n895_1206375_c1 3300050512 Bacteria 730
206 nmdc:mga0n895_209042_c1 3300050512 Bacteria 1982
207 nmdc:mga0rr50_1229631_c1 3300050513 Bacteria 636
208 nmdc:mga0a205_152127_c1 3300050515 Bacteria 2213
209 Ga0495601_0005170 3300053077 Bacteria 7584
210 Ga0495601_0908720 3300053077 Bacteria 556
211 Ga0495612_0000048 3300053078 Bacteria 56609
212 Ga0501084_0083642 3300054114 Bacteria 2679
213 Ga0501084_0369858 3300054114 Bacteria 1211
214 Ga0501082_0248738 3300060353 Bacteria 1547
215 Ga0501082_0502543 3300060353 Bacteria 1060
216 Ga0501082_0983088 3300060353 Bacteria 738
217 Ga0466962_0001779 3300061719 Bacteria 10141
218 Ga0466962_0212540 3300061719 Bacteria 946
219 Ga0530510_0008041 3300061734 Bacteria 7359
220 Ga0530510_0088232 3300061734 Bacteria 2260
221 Ga0466966_0117143
222 Ga0070683_100492714
223 Ga0070677_10000007
224 Ga0068868_100780495
225 Ga0070671_101265754
226 Ga0070674_100000026
227 Ga0070713_100693343
228 Ga0070710_10192605
229 Ga0070694_100116375
230 Ga0070697_100991294
231 Ga0070686_100584333
232 Ga0070695_100172437
233 Ga0070695_100186542
234 Ga0070696_100068906
235 Ga0068866_10000006
236 Ga0068862_100519253
237 Ga0075365_10011304
238 Ga0070716_100430000
239 Ga0075428_100016800
240 Ga0075428_100995870
241 Ga0075430_100019528
242 Ga0075431_100360177
243 Ga0075433_10082241
244 Ga0075434_100031892
245 Ga0068865_101061395
246 Ga0111539_10029043
247 Ga0105245_10088234
248 Ga0114129_10032139
249 Ga0114129_10082527
250 Ga0114129_10131528
251 Ga0114129_11435343
252 Ga0105243_11352105
253 Ga0105249_10828241
254 Ga0105239_10136406
255 Ga0157374_10006538
256 Ga0163162_10265167
257 Ga0163163_10329697
258 Ga0157376_11344780
259 Ga0213873_10048029
260 Ga0213874_10001037
261 Ga0213874_10234011
262 Ga0213876_10252365
263 Ga0213875_10004456
264 Ga0213875_10013011
265 Ga0213875_10036198
266 Ga0213875_10165614
267 Ga0207642_10000001
268 Ga0207642_10000003
269 Ga0207642_10000004
270 Ga0207664_10147535
271 Ga0207664_10753959
272 Ga0207644_10932181
273 Ga0207709_10791398
274 Ga0207669_10000041
275 Ga0207704_10691506
276 Ga0207639_10001070
277 Ga0207428_10083048
278 Ga0265337_1003357
279 Ga0307406_10398403
280 Ga0307409_100300574
281 Ga0307416_100547666
282 Ga0373933_0586786
283 Ga0373937_1846137
284 Ga0395899_0030240
285 Ga0395899_0328789
286 Ga0395899_0428733
287 Ga0395899_0760935
288 Ga0395900_0016352
289 Ga0395898_0015519
290 Ga0395898_0102667
291 Ga0395898_0108560
292 Ga0395905_0005342
293 Ga0395905_0315945
294 Ga0436364_0056314
295 Ga0436364_0177769
296 Ga0436364_0227018
297 Ga0436364_0332773
298 Ga0436364_0353125
299 Ga0436364_0362141
300 Ga0436364_0520267
301 Ga0436364_0543778
302 Ga0436364_0579394
303 Ga0395901_0001986
304 Ga0395901_0029626
305 Ga0436365_0112112
306 Ga0436365_0219317
307 Ga0436365_0266643
308 Ga0436365_0521800
309 Ga0436365_1915911
310 Ga0436360_0494816
311 Ga0436361_0703206
312 Ga0436361_0968857
313 Ga0436363_0152724
314 Ga0436363_0166336
315 Ga0436363_0200076
316 Ga0436363_0436839
317 Ga0436363_0578398
318 Ga0436363_1667785
319 Ga0436362_0471073
320 Ga0436362_0597238
321 Ga0436362_0600234
322 Ga0466969_0047267
323 Ga0466969_0330996
324 Ga0466965_0285948
325 Ga0466965_0904175
326 Ga0466966_0228036
327 Ga0466961_0017357
328 Ga0466961_0020095
329 Ga0466961_0024045
330 Ga0466961_0664080
331 Ga0466963_0000025
332 Ga0466963_0000961
333 Ga0466963_0311139
334 Ga0466963_0384932
335 Ga0466963_0548677
336 Ga0466964_0276537
337 Ga0466971_0014232
338 Ga0466971_0037709
339 Ga0466970_0039418
340 Ga0466970_0523966
341 Ga0466957_0086251
342 Ga0466957_0429268
343 Ga0466959_0000356
344 Ga0466959_0040512
345 Ga0466959_0069806
346 Ga0466959_0105787
347 Ga0466959_0113244
348 Ga0466959_0263006
349 Ga0466959_0536273
350 Ga0466959_0552518
351 Ga0466959_0608099
352 Ga0466959_0673258
353 Ga0466959_0732563
354 Ga0466959_0891691
355 Ga0466958_0000216
356 Ga0466958_0036597
357 Ga0466958_0055459
358 Ga0466958_0063396
359 Ga0466958_0078540
360 Ga0466958_0130481
361 Ga0466958_0616499
362 Ga0466958_0616760
363 Ga0466958_0622308
364 Ga0466958_0894169
365 Ga0466958_0906460
366 Ga0466967_0115321
367 Ga0466967_0358421
368 Ga0466967_1378866
369 Ga0495641_0072923
370 Ga0495651_0386075
371 Ga0495664_0180987
372 Ga0495608_0812744
373 Ga0495628_0330888
374 Ga0495642_0191229
375 Ga0495645_0110390
376 Ga0495668_0604216
377 Ga0495657_0273861
378 Ga0495623_0146836
379 Ga0495647_0000010
380 Ga0495669_0000545
381 Ga0495624_0000049
382 Ga0495604_0695896
383 Ga0495680_0000364
384 Ga0495679_007923
385 Ga0495602_0439139
386 Ga0496102_0450956
387 Ga0496105_0592347
388 Ga0496109_0052018
389 Ga0496110_0029249
390 Ga0496112_0381529
391 Ga0496114_0095365
392 Ga0496114_0117714
393 Ga0496115_0435100
394 Ga0501033_0410315
395 Ga0501039_1194347
396 Ga0501040_0071362
397 Ga0501041_0185694
398 Ga0501042_0074706
399 Ga0501046_0492288
400 Ga0501048_0018427
401 Ga0501048_0823449
402 Ga0501071_0315581
403 Ga0501072_0036371
404 Ga0501072_0079623
405 Ga0501072_0560959
406 Ga0501073_0343108
407 Ga0501074_0624372
408 Ga0501075_0039277
409 Ga0501075_0284246
410 Ga0501076_0320973
411 Ga0501076_1554996
412 Ga0501079_0316162
413 Ga0501080_1882820
414 Ga0501081_0320861
415 Ga0501045_0153168
416 nmdc:mga0yw44_151938_c1
417 nmdc:mga05p37_157869_c1
418 nmdc:mga05p37_66778_c1
419 nmdc:mga05p37_676755_c1
420 nmdc:mga05p37_877884_c1
421 nmdc:mga0qj67_57870_c1
422 nmdc:mga06r32_106369_c1
423 nmdc:mga06r32_590114_c1
424 nmdc:mga08y16_32725_c1
425 nmdc:mga0n895_1206375_c1
426 nmdc:mga0n895_209042_c1
427 nmdc:mga0rr50_1229631_c1
428 nmdc:mga0a205_152127_c1
429 Ga0495601_0005170
430 Ga0495601_0908720
431 Ga0495612_0000048
432 Ga0501084_0083642
433 Ga0501084_0369858
434 Ga0501082_0248738
435 Ga0501082_0502543
436 Ga0501082_0983088
437 Ga0466962_0001779
438 Ga0466962_0212540
439 Ga0530510_0008041
440 Ga0530510_0088232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

23

123

0.98

PF14437

MafB19-deam

MafB19-like deaminase

24

170

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tiy-assembly1.cif.gz_A x-ray structure of guanine deaminase from bacillus subtilis northeast structural genomics consortium target sr160 0.9169 12 101
5jfy-assembly1.cif.gz_B crystal structure of a plant cytidine deaminase 0.9043 5 102
5jfy-assembly2.cif.gz_D crystal structure of a plant cytidine deaminase 0.9031 5 102
2b3j-assembly2.cif.gz_D crystal structure of staphylococcus aureus trna adenosine deaminase, tada, in complex with rna 0.8961 11 140
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.8958 12 137
ID Description Score Start End Superfamily
af_A0A0R4IDF5_228_326_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9565 33 46 2.60.40.10
af_F8W4Y0_130_228_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9544 33 46 2.60.40.10
af_X1WBT0_462_567_2.60.40.1930 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.9457 33 47 2.60.40.1930
af_Q95Y87_1_153_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9275 13 96 3.40.140.10
af_F4JCX1_687_795_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9163 33 47 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7V1MIC5-F1-model_v4 Nucleoside deaminase 0.9643 6 90 GO:0002100
GO:0052717
AF-A0A2D9KL92-F1-model_v4 deleted 0.9578 10 90
AF-W1U0L0-F1-model_v4 CMP/dCMP deaminase zinc-binding protein 0.9571 11 92 GO:0002100
GO:0052717
AF-A0A6A3BFZ2-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9568 10 98 GO:0002100
GO:0008251
GO:0009507
AF-A0A099DB45-F1-model_v4 deleted 0.9568 10 98

Map