F332480

General Info

Members Datasets Scaffolds Average Seq Length
220 147 441 173

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0129739|Ga0436364_0129739_2257_2817
Length 186
Sequence VNPDISPTPHSLHADAVRVLTHWKSLHDALGQEQLRREYLDHLEAHPEGVWKSCRAGHITASALVVDPEHGRVLLTLHRKLRKWLQMGGHCEPEDATLAHAALREATEESGMAGITLLDGGPVKLDRHRTPCAWHLDVQYAAVAPPGAVPAVSDESLDLRWYTYEEVASVADDSVVRLVDRTRALV

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
10 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
11 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
12 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
13 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
14 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
15 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
16 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
17 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
20 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
21 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
22 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
23 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
24 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
25 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
26 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
27 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
28 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
29 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
30 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
31 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
32 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
33 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
34 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
35 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
36 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
37 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
38 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
39 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
40 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
41 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
42 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
43 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
44 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
45 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
46 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
47 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
48 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
49 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
50 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
51 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
52 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
53 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
54 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
55 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
56 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
57 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
58 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
59 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
60 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
61 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
62 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
63 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
64 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
65 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
66 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
67 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
68 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
69 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
70 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
71 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
72 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
73 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
74 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
98 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
99 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
106 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
109 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
110 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
111 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
112 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
113 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
114 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
115 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
116 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
117 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
118 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
119 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
120 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
121 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
122 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
123 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
128 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
129 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
130 2808606448 Streptomyces sp. 193411 Isolate Unclassified
131 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
132 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
133 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
134 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
135 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
136 2867369537 Streptomyces sp. Z26 Isolate Unclassified
137 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
138 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
139 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
140 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
141 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
142 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
143 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
144 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
145 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
146 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
147 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.45
Metatranscriptomes 0
Isolates 9.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.91
Nodule 0.91
Rhizoplane 1.82
Rhizosphere 71.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0129739 3300037853 Bacteria 14389
2 rootH1_10016089 3300003316 Bacteria 7731
3 rootH1_10016089 3300003323 Bacteria 10325
4 rootH2_10017468 3300003320 Bacteria 1680
5 rootH2_10137193 3300003320 Bacteria 5015
6 rootL2_10139521 3300003322 Bacteria 1284
7 rootH1_10080847 3300003323 Bacteria 1119
8 Ga0070665_100086712 3300005548 Bacteria 3136
9 Ga0075365_10274066 3300006038 Bacteria 1187
10 Ga0075363_100016445 3300006048 Bacteria 3654
11 Ga0075370_10099449 3300006353 Bacteria 1682
12 Ga0105245_10230264 3300009098 Bacteria 1792
13 Ga0182008_10001423 3300014497 Bacteria 16047
14 Ga0157376_10793481 3300014969 Bacteria 959
15 Ga0182007_10000521 3300015262 Bacteria 22653
16 Ga0182005_1004749 3300015265 Bacteria 4337
17 Ga0209758_1004478 3300025297 Bacteria 11604
18 Ga0207426_1013862 3300025302 Bacteria 2971
19 Ga0207426_1034779 3300025302 Bacteria 1614
20 Ga0307517_10000910 3300028786 Bacteria 50175
21 Ga0307515_10078908 3300028794 Bacteria 4321
22 Ga0307511_10279900 3300030521 Bacteria 772
23 Ga0307513_10012776 3300031456 Bacteria 10342
24 Ga0307514_10007626 3300031649 Bacteria 9320
25 Ga0307514_10041920 3300031649 Bacteria 3603
26 Ga0307514_10089832 3300031649 Bacteria 2243
27 Ga0307516_10002231 3300031730 Bacteria 26212
28 Ga0307516_10039372 3300031730 Bacteria 4712
29 Ga0307516_10162425 3300031730 Bacteria 1983
30 Ga0307416_100327917 3300032002 Bacteria 1537
31 Ga0307416_102583549 3300032002 Bacteria 606
32 Ga0307510_10009237 3300033180 Bacteria 11748
33 Ga0395898_0094853 3300037466 Bacteria 2867
34 Ga0439439_0015638 3300041406 Bacteria 1855
35 Ga0451795_1228662 3300041456 Bacteria 969
36 Ga0451800_0411153 3300041459 Bacteria 1206
37 Ga0451802_1977225 3300041460 Bacteria 579
38 Ga0451807_1189252 3300041486 Bacteria 1696
39 Ga0451853_1474166 3300041512 Bacteria 1126
40 Ga0451853_2744248 3300041512 Bacteria 873
41 Ga0451853_3348474 3300041512 Bacteria 4400
42 Ga0450894_000117 3300042131 Bacteria 13529
43 Ga0450895_004808 3300042132 Bacteria 1074
44 Ga0450898_001463 3300042134 Bacteria 3118
45 Ga0450899_000640 3300042135 Bacteria 3961
46 Ga0450906_000607 3300042145 Bacteria 7631
47 Ga0466969_0049563 3300044656 Bacteria 2072
48 Ga0466972_0012411 3300044658 Bacteria 4281
49 Ga0466972_0092438 3300044658 Bacteria 1434
50 Ga0466965_0369268 3300044683 Bacteria 788
51 Ga0466966_0001547 3300044684 Bacteria 14749
52 Ga0466961_0011543 3300044693 Bacteria 5650
53 Ga0466963_0000231 3300044694 Bacteria 24052
54 Ga0466968_0092027 3300044735 Bacteria 1345
55 Ga0466970_0004924 3300044765 Bacteria 6594
56 Ga0466957_0065885 3300044842 Bacteria 2232
57 Ga0466959_0487479 3300045049 Bacteria 834
58 Ga0466958_0409750 3300045836 Bacteria 876
59 Ga0466967_0023110 3300045976 Bacteria 5090
60 Ga0466967_0418159 3300045976 Bacteria 1306
61 Ga0495592_0002138 3300046454 Bacteria 13908
62 Ga0495664_0062260 3300046477 Bacteria 2222
63 Ga0495594_0073865 3300046499 Bacteria 1899
64 Ga0495594_0330906 3300046499 Bacteria 867
65 Ga0495608_0368345 3300046511 Bacteria 882
66 Ga0495628_0086223 3300046516 Bacteria 2435
67 Ga0495632_0028142 3300046519 Bacteria 2936
68 Ga0495643_0002041 3300046522 Bacteria 16783
69 Ga0495652_0013863 3300046529 Bacteria 7252
70 Ga0495640_0004214 3300046533 Bacteria 11507
71 Ga0495640_0015287 3300046533 Bacteria 5778
72 Ga0495633_0031219 3300046558 Bacteria 2585
73 Ga0495667_0249281 3300046559 Bacteria 1130
74 Ga0495588_0127617 3300046674 Bacteria 1342
75 Ga0495613_0002467 3300046689 Bacteria 13939
76 Ga0495624_0019419 3300046690 Bacteria 4537
77 Ga0495670_0009597 3300046691 Bacteria 4754
78 Ga0495671_0250345 3300046692 Bacteria 855
79 Ga0495589_0027104 3300046794 Bacteria 2898
80 Ga0495600_0123173 3300046809 Bacteria 1686
81 Ga0495604_0006274 3300047317 Bacteria 9435
82 Ga0495604_0007836 3300047317 Bacteria 8454
83 Ga0495636_0017613 3300047318 Bacteria 2860
84 Ga0495676_0007919 3300047321 Bacteria 9743
85 Ga0495687_044746 3300047443 Bacteria 1921
86 Ga0495687_079113 3300047443 Bacteria 1293
87 Ga0495675_0008040 3300047444 Bacteria 6528
88 Ga0495679_033554 3300047446 Bacteria 1639
89 Ga0495685_002807 3300047447 Bacteria 5489
90 Ga0495685_006470 3300047447 Bacteria 3835
91 Ga0495681_0002348 3300047470 Bacteria 13585
92 Ga0501031_0005508 3300049568 Bacteria 8242
93 Ga0501031_0059061 3300049568 Bacteria 2499
94 Ga0501031_0919468 3300049568 Bacteria 560
95 Ga0501032_0003318 3300049569 Bacteria 12384
96 Ga0501032_0003516 3300049569 Bacteria 11969
97 Ga0501032_0051812 3300049569 Bacteria 2767
98 Ga0501032_0098991 3300049569 Bacteria 1932
99 Ga0501033_0008010 3300049570 Bacteria 8186
100 Ga0501033_0010848 3300049570 Bacteria 6986
101 Ga0501033_0040390 3300049570 Bacteria 3483
102 Ga0501033_0041033 3300049570 Bacteria 3454
103 Ga0501034_0014260 3300049571 Bacteria 8189
104 Ga0501034_0038272 3300049571 Bacteria 4857
105 Ga0501034_0080785 3300049571 Bacteria 3254
106 Ga0501034_0153230 3300049571 Bacteria 2280
107 Ga0501034_0309206 3300049571 Bacteria 1515
108 Ga0501036_0010680 3300049572 Bacteria 7589
109 Ga0501036_0018335 3300049572 Bacteria 5861
110 Ga0501036_0022764 3300049572 Bacteria 5275
111 Ga0501036_0025012 3300049572 Bacteria 5035
112 Ga0501036_0046447 3300049572 Bacteria 3677
113 Ga0501037_0006521 3300049573 Bacteria 8539
114 Ga0501037_0017845 3300049573 Bacteria 5224
115 Ga0501037_0041489 3300049573 Bacteria 3384
116 Ga0501038_0007720 3300049574 Bacteria 9919
117 Ga0501038_0072971 3300049574 Bacteria 2907
118 Ga0501038_0362219 3300049574 Bacteria 1127
119 Ga0501038_0482973 3300049574 Bacteria 949
120 Ga0501038_0984737 3300049574 Bacteria 619
121 Ga0501039_0042269 3300049575 Bacteria 3521
122 Ga0501039_0047889 3300049575 Bacteria 3304
123 Ga0501039_1023560 3300049575 Bacteria 641
124 Ga0501040_0004761 3300049576 Bacteria 8799
125 Ga0501041_0004784 3300049577 Bacteria 7863
126 Ga0501042_0005695 3300049578 Bacteria 8042
127 Ga0501042_0013620 3300049578 Bacteria 5538
128 Ga0501042_0113019 3300049578 Bacteria 1955
129 Ga0501043_0001716 3300049579 Bacteria 18934
130 Ga0501043_0009179 3300049579 Bacteria 7772
131 Ga0501043_0013869 3300049579 Bacteria 6306
132 Ga0501043_0058332 3300049579 Bacteria 3030
133 Ga0501046_0041862 3300049580 Bacteria 3653
134 Ga0501046_0090618 3300049580 Bacteria 2352
135 Ga0501046_0382718 3300049580 Bacteria 1018
136 Ga0501046_0464175 3300049580 Bacteria 909
137 Ga0501047_0000518 3300049581 Bacteria 41734
138 Ga0501047_0004199 3300049581 Bacteria 13565
139 Ga0501047_0013187 3300049581 Bacteria 7827
140 Ga0501047_0016216 3300049581 Bacteria 7108
141 Ga0501047_0100223 3300049581 Bacteria 2776
142 Ga0501047_0110179 3300049581 Bacteria 2636
143 Ga0501047_0145813 3300049581 Bacteria 2244
144 Ga0501047_0516727 3300049581 Bacteria 1020
145 Ga0501048_0015445 3300049582 Bacteria 5639
146 Ga0501048_0051382 3300049582 Bacteria 2934
147 Ga0501048_0789383 3300049582 Bacteria 682
148 Ga0501067_0005423 3300049583 Bacteria 7080
149 Ga0501068_0007979 3300049584 Bacteria 5869
150 Ga0501068_0132049 3300049584 Bacteria 1562
151 Ga0501069_0002415 3300049585 Bacteria 9498
152 Ga0501070_0013151 3300049586 Bacteria 6974
153 Ga0501070_0017272 3300049586 Bacteria 6058
154 Ga0501071_0000283 3300049587 Bacteria 24193
155 Ga0501072_0003494 3300049588 Bacteria 11831
156 Ga0501073_0006672 3300049589 Bacteria 8594
157 Ga0501074_0007181 3300049590 Bacteria 8043
158 Ga0501076_0007524 3300049592 Bacteria 7925
159 Ga0501077_0023917 3300049593 Bacteria 3875
160 Ga0501079_0018291 3300049741 Bacteria 5354
161 Ga0501080_0133951 3300049742 Bacteria 2293
162 Ga0501083_0012672 3300049744 Bacteria 5899
163 Ga0501035_0004403 3300049822 Bacteria 13367
164 Ga0501035_0024667 3300049822 Bacteria 5513
165 Ga0501035_0026916 3300049822 Bacteria 5258
166 Ga0501035_0099498 3300049822 Bacteria 2552
167 Ga0501035_0415350 3300049822 Bacteria 1117
168 Ga0501035_0512295 3300049822 Bacteria 986
169 Ga0501044_0003734 3300049823 Bacteria 17103
170 Ga0501044_0010940 3300049823 Bacteria 9847
171 Ga0501044_0029579 3300049823 Bacteria 5775
172 Ga0501044_0062029 3300049823 Bacteria 3822
173 Ga0501044_0065712 3300049823 Bacteria 3699
174 Ga0501044_0071146 3300049823 Bacteria 3537
175 Ga0501044_0171173 3300049823 Bacteria 2143
176 Ga0501044_0552420 3300049823 Bacteria 1048
177 Ga0501044_0571063 3300049823 Bacteria 1026
178 Ga0501045_0069413 3300049824 Bacteria 2591
179 Ga0501045_0442232 3300049824 Bacteria 967
180 nmdc:mga0yw44_169424_c1 3300050492 Bacteria 1433
181 nmdc:mga07m45_13159_c1 3300050496 Bacteria 4382
182 Ga0500578_0025258 3300053086 Bacteria 3811
183 Ga0500553_176838 3300053101 Bacteria 773
184 Ga0500560_020863 3300053107 Bacteria 1865
185 Ga0500569_144228 3300053109 Bacteria 801
186 Ga0500621_033772 3300053126 Bacteria 2044
187 Ga0500628_002178 3300053129 Bacteria 3267
188 Ga0500652_003324 3300053131 Bacteria 4875
189 Ga0500658_0356070 3300053134 Bacteria 671
190 Ga0500573_0009416 3300053140 Bacteria 5420
191 Ga0500577_0261069 3300053142 Bacteria 753
192 Ga0500600_0032795 3300053149 Bacteria 3040
193 Ga0500616_0027787 3300053153 Bacteria 3122
194 Ga0500633_0110100 3300053160 Bacteria 1019
195 Ga0500634_0068691 3300053161 Bacteria 1860
196 Ga0500656_001423 3300053732 Bacteria 2059
197 Ga0500587_013208 3300053739 Bacteria 1042
198 Ga0501084_0034840 3300054114 Bacteria 4209
199 Ga0501082_0010023 3300060353 Bacteria 8168
200 Ga0466962_0021136 3300061719 Bacteria 3126
201 2547408553 2547132111 Bacteria 8013147
202 2554256378 2554235005 Bacteria 6457341
203 2784590240 2784132148 Bacteria 8627943
204 2809233914 2808606448 Bacteria 8656184
205 2812478932 2811994917 Bacteria 7761064
206 2862284940 2862281513 Bacteria 9621493
207 2862388836 2862382967 Bacteria 10317375
208 2862707038 2862705112 Bacteria 6563286
209 2863408431 2863404153 Bacteria 9672205
210 2867373694 2867369537 Bacteria 6501581
211 2954005281 2954002825 Bacteria 9173742
212 2990064559 2990059506 Bacteria 9321252
213 2990091758 2990088156 Bacteria 6657676
214 2997603047 2997600082 Bacteria 9896405
215 3006323835 3006321560 Bacteria 8247479
216 3006498081 3006493962 Bacteria 8825450
217 8008487927 8008485437 Bacteria 7198341
218 8008562601 8008558824 Bacteria 10610750
219 8023627976 8023623736 Bacteria 8593882
220 8025526553 8025524527 Bacteria 7197316
221 8033690870 8033684223 Bacteria 6906479
222 Ga0436364_0129739
223 rootH1_10016089
224 rootH2_10017468
225 rootH2_10137193
226 rootL2_10139521
227 rootH1_10080847
228 Ga0070665_100086712
229 Ga0075365_10274066
230 Ga0075363_100016445
231 Ga0075370_10099449
232 Ga0105245_10230264
233 Ga0182008_10001423
234 Ga0157376_10793481
235 Ga0182007_10000521
236 Ga0182005_1004749
237 Ga0209758_1004478
238 Ga0207426_1013862
239 Ga0207426_1034779
240 Ga0307517_10000910
241 Ga0307515_10078908
242 Ga0307511_10279900
243 Ga0307513_10012776
244 Ga0307514_10007626
245 Ga0307514_10041920
246 Ga0307514_10089832
247 Ga0307516_10002231
248 Ga0307516_10039372
249 Ga0307516_10162425
250 Ga0307416_100327917
251 Ga0307416_102583549
252 Ga0307510_10009237
253 Ga0395898_0094853
254 Ga0439439_0015638
255 Ga0451795_1228662
256 Ga0451800_0411153
257 Ga0451802_1977225
258 Ga0451807_1189252
259 Ga0451853_1474166
260 Ga0451853_2744248
261 Ga0451853_3348474
262 Ga0450894_000117
263 Ga0450895_004808
264 Ga0450898_001463
265 Ga0450899_000640
266 Ga0450906_000607
267 Ga0466969_0049563
268 Ga0466972_0012411
269 Ga0466972_0092438
270 Ga0466965_0369268
271 Ga0466966_0001547
272 Ga0466961_0011543
273 Ga0466963_0000231
274 Ga0466968_0092027
275 Ga0466970_0004924
276 Ga0466957_0065885
277 Ga0466959_0487479
278 Ga0466958_0409750
279 Ga0466967_0023110
280 Ga0466967_0418159
281 Ga0495592_0002138
282 Ga0495664_0062260
283 Ga0495594_0073865
284 Ga0495594_0330906
285 Ga0495608_0368345
286 Ga0495628_0086223
287 Ga0495632_0028142
288 Ga0495643_0002041
289 Ga0495652_0013863
290 Ga0495640_0004214
291 Ga0495640_0015287
292 Ga0495633_0031219
293 Ga0495667_0249281
294 Ga0495588_0127617
295 Ga0495613_0002467
296 Ga0495624_0019419
297 Ga0495670_0009597
298 Ga0495671_0250345
299 Ga0495589_0027104
300 Ga0495600_0123173
301 Ga0495604_0006274
302 Ga0495604_0007836
303 Ga0495636_0017613
304 Ga0495676_0007919
305 Ga0495687_044746
306 Ga0495687_079113
307 Ga0495675_0008040
308 Ga0495679_033554
309 Ga0495685_002807
310 Ga0495685_006470
311 Ga0495681_0002348
312 Ga0501031_0005508
313 Ga0501031_0059061
314 Ga0501031_0919468
315 Ga0501032_0003318
316 Ga0501032_0003516
317 Ga0501032_0051812
318 Ga0501032_0098991
319 Ga0501033_0008010
320 Ga0501033_0010848
321 Ga0501033_0040390
322 Ga0501033_0041033
323 Ga0501034_0014260
324 Ga0501034_0038272
325 Ga0501034_0080785
326 Ga0501034_0153230
327 Ga0501034_0309206
328 Ga0501036_0010680
329 Ga0501036_0018335
330 Ga0501036_0022764
331 Ga0501036_0025012
332 Ga0501036_0046447
333 Ga0501037_0006521
334 Ga0501037_0017845
335 Ga0501037_0041489
336 Ga0501038_0007720
337 Ga0501038_0072971
338 Ga0501038_0362219
339 Ga0501038_0482973
340 Ga0501038_0984737
341 Ga0501039_0042269
342 Ga0501039_0047889
343 Ga0501039_1023560
344 Ga0501040_0004761
345 Ga0501041_0004784
346 Ga0501042_0005695
347 Ga0501042_0013620
348 Ga0501042_0113019
349 Ga0501043_0001716
350 Ga0501043_0009179
351 Ga0501043_0013869
352 Ga0501043_0058332
353 Ga0501046_0041862
354 Ga0501046_0090618
355 Ga0501046_0382718
356 Ga0501046_0464175
357 Ga0501047_0000518
358 Ga0501047_0004199
359 Ga0501047_0013187
360 Ga0501047_0016216
361 Ga0501047_0100223
362 Ga0501047_0110179
363 Ga0501047_0145813
364 Ga0501047_0516727
365 Ga0501048_0015445
366 Ga0501048_0051382
367 Ga0501048_0789383
368 Ga0501067_0005423
369 Ga0501068_0007979
370 Ga0501068_0132049
371 Ga0501069_0002415
372 Ga0501070_0013151
373 Ga0501070_0017272
374 Ga0501071_0000283
375 Ga0501072_0003494
376 Ga0501073_0006672
377 Ga0501074_0007181
378 Ga0501076_0007524
379 Ga0501077_0023917
380 Ga0501079_0018291
381 Ga0501080_0133951
382 Ga0501083_0012672
383 Ga0501035_0004403
384 Ga0501035_0024667
385 Ga0501035_0026916
386 Ga0501035_0099498
387 Ga0501035_0415350
388 Ga0501035_0512295
389 Ga0501044_0003734
390 Ga0501044_0010940
391 Ga0501044_0029579
392 Ga0501044_0062029
393 Ga0501044_0065712
394 Ga0501044_0071146
395 Ga0501044_0171173
396 Ga0501044_0552420
397 Ga0501044_0571063
398 Ga0501045_0069413
399 Ga0501045_0442232
400 nmdc:mga0yw44_169424_c1
401 nmdc:mga07m45_13159_c1
402 Ga0500578_0025258
403 Ga0500553_176838
404 Ga0500560_020863
405 Ga0500569_144228
406 Ga0500621_033772
407 Ga0500628_002178
408 Ga0500652_003324
409 Ga0500658_0356070
410 Ga0500573_0009416
411 Ga0500577_0261069
412 Ga0500600_0032795
413 Ga0500616_0027787
414 Ga0500633_0110100
415 Ga0500634_0068691
416 Ga0500656_001423
417 Ga0500587_013208
418 Ga0501084_0034840
419 Ga0501082_0010023
420 Ga0466962_0021136
421 2547408553
422 2554256378
423 2784590240
424 2809233914
425 2812478932
426 2862284940
427 2862388836
428 2862707038
429 2863408431
430 2867373694
431 2954005281
432 2990064559
433 2990091758
434 2997603047
435 3006323835
436 3006498081
437 8008487927
438 8008562601
439 8023627976
440 8025526553
441 8033690870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

56

179

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vc9-assembly2.cif.gz_B crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant-mg2+-atp complex 0.8914 44 170
1vcd-assembly1.cif.gz_A crystal structure of a t.thermophilus hb8 ap6a hydrolase ndx1 0.8658 44 171
1ktg-assembly1.cif.gz_A crystal structure of a c. elegans ap4a hydrolase binary complex 0.8646 44 172
5ggc-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with phosphate and magnesium ions (excess magnesium, i) 0.8594 44 169
6m72-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgdp 0.856 44 169
ID Description Score Start End Superfamily
af_K7KC87_1_156_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.8971 3 34 1.20.1410.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8796 45 170 3.90.79.10
1ktgA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8646 44 172 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8597 45 170 3.90.79.10
af_Q4V6M1_1_140_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8486 44 172 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A6G3DJ57-F1-model_v4 NUDIX domain-containing protein 0.9837 1 170
AF-A0A1I5CJZ2-F1-model_v4 ADP-ribose pyrophosphatase YjhB, NUDIX family 0.9834 1 170
AF-A0A1H4YBI9-F1-model_v4 Nucleoside diphosphate-linked moiety X motif 17 0.9829 1 170 GO:0005777
GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
AF-L7F9L2-F1-model_v4 Nucleoside diphosphate-linked moiety X motif 17 0.9825 1 170 GO:0005777
GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
AF-A0A0X3SHM1-F1-model_v4 NUDIX hydrolase 0.9809 1 173 GO:0016787

Map