F332385

General Info

Members Datasets Scaffolds Average Seq Length
220 141 432 99

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10144383|Ga0307517_101443832
Length 109
Sequence MREAGEMHNLGFALDGAWRVLLASLILGAGLPALFALGVRSLAWGAGGDAEVHESGVTGPTPRPIGTVLGWACFVVVLAGVILGITFIVASGFGKALSFEHIYPTIVNK

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
72 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
90 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
91 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
92 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
95 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
96 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
102 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
103 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
104 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
105 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
125 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
126 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
127 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
128 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
129 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
130 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
131 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
132 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
135 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
136 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
137 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
138 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
139 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
140 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
141 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 0
Rhizoplane 2.73
Rhizosphere 66.82
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10144383 3300028786 Bacteria 1657
2 rootH2_10086722 3300003320 Bacteria 2003
3 Ga0070676_10187283 3300005328 Bacteria 1349
4 Ga0070680_100299232 3300005336 Bacteria 1364
5 Ga0070682_101097363 3300005337 Bacteria 666
6 Ga0070682_101506007 3300005337 Bacteria 579
7 Ga0068868_100255663 3300005338 Bacteria 1476
8 Ga0070689_101283527 3300005340 Bacteria 659
9 Ga0070692_10939930 3300005345 Bacteria 600
10 Ga0070668_100000198 3300005347 Bacteria 39448
11 Ga0070668_100058027 3300005347 Bacteria 2993
12 Ga0070668_100296822 3300005347 Bacteria 1354
13 Ga0070668_100372712 3300005347 Bacteria 1213
14 Ga0070668_102120827 3300005347 Bacteria 519
15 Ga0070669_100487473 3300005353 Bacteria 1021
16 Ga0070669_100547546 3300005353 Bacteria 964
17 Ga0070671_100852770 3300005355 Bacteria 795
18 Ga0070709_10834670 3300005434 Bacteria 725
19 Ga0070713_100678526 3300005436 Bacteria 983
20 Ga0070678_100839861 3300005456 Bacteria 836
21 Ga0070678_101873776 3300005456 Bacteria 566
22 Ga0070681_11623505 3300005458 Bacteria 572
23 Ga0068867_101023491 3300005459 Bacteria 750
24 Ga0070685_10978464 3300005466 Bacteria 634
25 Ga0070685_11612518 3300005466 Bacteria 502
26 Ga0070679_100287546 3300005530 Bacteria 1596
27 Ga0070679_100808254 3300005530 Bacteria 881
28 Ga0070665_100311543 3300005548 Bacteria 1578
29 Ga0070665_100940170 3300005548 Bacteria 877
30 Ga0070665_100982738 3300005548 Bacteria 856
31 Ga0070665_101140376 3300005548 Bacteria 791
32 Ga0070665_101184468 3300005548 Bacteria 775
33 Ga0070665_102541439 3300005548 Bacteria 513
34 Ga0068855_102607213 3300005563 Bacteria 501
35 Ga0070664_101575940 3300005564 Bacteria 622
36 Ga0070702_100882095 3300005615 Bacteria 699
37 Ga0068859_100359640 3300005617 Bacteria 1551
38 Ga0068859_102151924 3300005617 Bacteria 616
39 Ga0068864_101491796 3300005618 Bacteria 679
40 Ga0068861_100175027 3300005719 Bacteria 1782
41 Ga0068861_100407364 3300005719 Bacteria 1208
42 Ga0068861_101163021 3300005719 Bacteria 744
43 Ga0068870_10789788 3300005840 Bacteria 662
44 Ga0068858_100759974 3300005842 Bacteria 945
45 Ga0068860_100208266 3300005843 Bacteria 1896
46 Ga0068860_100340875 3300005843 Bacteria 1474
47 Ga0068862_100027048 3300005844 Bacteria 4825
48 Ga0068862_100594298 3300005844 Bacteria 1062
49 Ga0081539_10167417 3300005985 Bacteria 1042
50 Ga0097621_101267538 3300006237 Bacteria 695
51 Ga0068871_101850082 3300006358 Bacteria 573
52 Ga0075434_100285528 3300006871 Bacteria 1670
53 Ga0075429_101673392 3300006880 Unclassified 553
54 Ga0097620_100359625 3300006931 Bacteria 1551
55 Ga0097620_102151774 3300006931 Bacteria 616
56 Ga0105247_10090378 3300009101 Bacteria 1942
57 Ga0114129_10665248 3300009147 Bacteria 1342
58 Ga0105242_12270658 3300009176 Bacteria 589
59 Ga0105239_11980925 3300010375 Bacteria 676
60 Ga0157369_11622111 3300013105 Bacteria 658
61 Ga0157369_11622159 3300013105 Bacteria 658
62 Ga0157374_11281686 3300013296 Bacteria 755
63 Ga0163162_11045129 3300013306 Bacteria 924
64 Ga0157372_11881755 3300013307 Bacteria 688
65 Ga0157375_10809124 3300013308 Bacteria 1085
66 Ga0163163_10613847 3300014325 Bacteria 1151
67 Ga0163163_10667843 3300014325 Bacteria 1103
68 Ga0182008_10121339 3300014497 Bacteria 1299
69 Ga0182008_10896847 3300014497 Bacteria 521
70 Ga0157379_10085536 3300014968 Bacteria 2826
71 Ga0157379_12160288 3300014968 Unclassified 552
72 Ga0207710_10303718 3300025900 Bacteria 807
73 Ga0207643_10057989 3300025908 Bacteria 2205
74 Ga0207660_11181198 3300025917 Bacteria 623
75 Ga0207652_11206334 3300025921 Bacteria 658
76 Ga0207681_10497846 3300025923 Bacteria 997
77 Ga0207700_10344258 3300025928 Bacteria 1297
78 Ga0207691_11002346 3300025940 Bacteria 697
79 Ga0207689_10159970 3300025942 Bacteria 1856
80 Ga0207661_10380964 3300025944 Bacteria 1277
81 Ga0207679_10421289 3300025945 Bacteria 1178
82 Ga0207679_10546395 3300025945 Bacteria 1039
83 Ga0207667_11243423 3300025949 Bacteria 723
84 Ga0207668_10015342 3300025972 Bacteria 4758
85 Ga0207668_10434597 3300025972 Bacteria 1117
86 Ga0207668_10966937 3300025972 Bacteria 760
87 Ga0207678_10063173 3300026067 Bacteria 3182
88 Ga0207641_10587604 3300026088 Bacteria 1089
89 Ga0207648_10308279 3300026089 Bacteria 1421
90 Ga0207676_10235990 3300026095 Bacteria 1638
91 Ga0207676_11242580 3300026095 Bacteria 739
92 Ga0207674_11494067 3300026116 Bacteria 645
93 Ga0207675_100230163 3300026118 Bacteria 1788
94 Ga0207675_100502864 3300026118 Bacteria 1207
95 Ga0207675_102438572 3300026118 Unclassified 535
96 Ga0207683_10540048 3300026121 Bacteria 1078
97 Ga0207683_12018993 3300026121 Bacteria 525
98 Ga0268266_10493920 3300028379 Bacteria 1168
99 Ga0268266_11361458 3300028379 Bacteria 685
100 Ga0268266_11639323 3300028379 Bacteria 619
101 Ga0268266_11832708 3300028379 Bacteria 581
102 Ga0268265_10111041 3300028380 Bacteria 2238
103 Ga0268265_10676763 3300028380 Bacteria 994
104 Ga0268265_10712124 3300028380 Bacteria 971
105 Ga0268264_10150789 3300028381 Bacteria 2084
106 Ga0268264_11161095 3300028381 Bacteria 781
107 Ga0268264_11484411 3300028381 Bacteria 689
108 Ga0307517_10221833 3300028786 Bacteria 1148
109 Ga0307517_10314045 3300028786 Bacteria 871
110 Ga0307515_10000315 3300028794 Bacteria 119286
111 Ga0307515_10002303 3300028794 Bacteria 41725
112 Ga0307515_10057164 3300028794 Bacteria 5651
113 Ga0307515_10122024 3300028794 Bacteria 2943
114 Ga0307511_10287612 3300030521 Bacteria 754
115 Ga0307512_10016404 3300030522 Bacteria 6836
116 Ga0307512_10056290 3300030522 Bacteria 3090
117 Ga0307512_10184413 3300030522 Bacteria 1165
118 Ga0307512_10366393 3300030522 Bacteria 625
119 Ga0307513_10073906 3300031456 Bacteria 3547
120 Ga0307509_10019557 3300031507 Bacteria 7715
121 Ga0307509_10123428 3300031507 Bacteria 2562
122 Ga0307509_10263940 3300031507 Bacteria 1495
123 Ga0307509_10615050 3300031507 Bacteria 758
124 Ga0307509_10857648 3300031507 Bacteria 573
125 Ga0307508_10008262 3300031616 Bacteria 9637
126 Ga0307508_10014199 3300031616 Bacteria 7264
127 Ga0307508_10048506 3300031616 Bacteria 3783
128 Ga0307508_10161919 3300031616 Bacteria 1841
129 Ga0307508_10186568 3300031616 Bacteria 1676
130 Ga0307508_10603587 3300031616 Bacteria 699
131 Ga0307516_10011877 3300031730 Bacteria 9427
132 Ga0307516_10079685 3300031730 Bacteria 3119
133 Ga0307516_10122518 3300031730 Bacteria 2388
134 Ga0307516_10174507 3300031730 Bacteria 1887
135 Ga0307516_10182754 3300031730 Bacteria 1829
136 Ga0307516_10389856 3300031730 Bacteria 1053
137 Ga0307516_10662214 3300031730 Bacteria 699
138 Ga0307405_10350327 3300031731 Bacteria 1139
139 Ga0307405_11308037 3300031731 Bacteria 631
140 Ga0307405_12151197 3300031731 Bacteria 501
141 Ga0307413_10362292 3300031824 Bacteria 1123
142 Ga0307410_11423742 3300031852 Bacteria 609
143 Ga0326468_10000638 3300031889 Bacteria 3611
144 Ga0307406_10179703 3300031901 Bacteria 1539
145 Ga0307406_10630220 3300031901 Bacteria 888
146 Ga0307407_10250699 3300031903 Bacteria 1213
147 Ga0307412_10780310 3300031911 Bacteria 828
148 Ga0307409_100007569 3300031995 Bacteria 6509
149 Ga0307409_100104702 3300031995 Bacteria 2357
150 Ga0307416_100077563 3300032002 Bacteria 2791
151 Ga0307414_10368846 3300032004 Bacteria 1238
152 Ga0307415_101441535 3300032126 Bacteria 657
153 Ga0307510_10416507 3300033180 Bacteria 786
154 Ga0373930_0048620 3300034816 Bacteria 921
155 Ga0373950_0005994 3300034818 Bacteria 1834
156 Ga0373940_0004636 3300035088 Bacteria 2918
157 Ga0373951_0000008 3300035091 Bacteria 80784
158 Ga0373932_0095556 3300035112 Bacteria 960
159 Ga0373941_0062533 3300035115 Unclassified 1215
160 Ga0373942_0000161 3300035207 Bacteria 16314
161 Ga0373962_0179404 3300035242 Bacteria 707
162 Ga0373935_0016701 3300035692 Bacteria 4443
163 Ga0436364_0899233 3300037853 Bacteria 1801
164 Ga0451791_1684666 3300041451 Bacteria 1382
165 Ga0451797_0279864 3300041453 Bacteria 740
166 Ga0451797_0769259 3300041453 Bacteria 564
167 Ga0451802_1023416 3300041460 Bacteria 567
168 Ga0451833_0115020 3300041491 Bacteria 516
169 Ga0451841_0251438 3300041498 Bacteria 735
170 Ga0451841_1278759 3300041498 Bacteria 800
171 Ga0451845_0472487 3300041501 Bacteria 733
172 Ga0451843_0303618 3300041509 Bacteria 517
173 Ga0451853_0143022 3300041512 Bacteria 1919
174 Ga0451853_0287877 3300041512 Bacteria 2520
175 Ga0451853_1872381 3300041512 Bacteria 906
176 Ga0451853_2308582 3300041512 Bacteria 544
177 Ga0439463_210437 3300042016 Bacteria 505
178 Ga0466961_0380233 3300044693 Bacteria 858
179 Ga0466963_0380500 3300044694 Bacteria 995
180 Ga0466957_0394920 3300044842 Bacteria 945
181 Ga0466967_0782888 3300045976 Bacteria 947
182 Ga0495638_0266900 3300046460 Unclassified 936
183 Ga0495594_0070938 3300046499 Bacteria 1937
184 Ga0495594_0284266 3300046499 Bacteria 942
185 Ga0495632_0064931 3300046519 Bacteria 1764
186 Ga0495686_0086661 3300047472 Bacteria 1906
187 Ga0496108_0000168 3300048911 Bacteria 61503
188 Ga0496120_0383661 3300048923 Bacteria 624
189 Ga0496122_0410653 3300048925 Bacteria 684
190 Ga0496123_0072872 3300048926 Bacteria 2134
191 Ga0501042_0020649 3300049578 Bacteria 4585
192 Ga0501048_0462469 3300049582 Bacteria 909
193 Ga0501076_0189553 3300049592 Bacteria 1678
194 nmdc:mga0n895_793191_c1 3300050512 Bacteria 938
195 Ga0500578_0561841 3300053086 Bacteria 633
196 Ga0500644_0011452 3300053088 Bacteria 2424
197 Ga0500646_0080940 3300053090 Bacteria 991
198 Ga0500651_0148832 3300053093 Bacteria 1407
199 Ga0500641_0141848 3300053096 Bacteria 1038
200 Ga0500641_0292765 3300053096 Bacteria 671
201 Ga0500594_0290137 3300053118 Bacteria 547
202 Ga0500652_021324 3300053131 Bacteria 2439
203 Ga0500652_031348 3300053131 Bacteria 2085
204 Ga0500589_246612 3300053147 Bacteria 658
205 Ga0500600_0066654 3300053149 Bacteria 1987
206 Ga0500616_0004706 3300053153 Bacteria 9607
207 Ga0500630_144635 3300053159 Bacteria 1017
208 Ga0500630_191504 3300053159 Bacteria 809
209 Ga0500630_275644 3300053159 Bacteria 569
210 Ga0500634_0206653 3300053161 Bacteria 857
211 2729907865 2728369276 Bacteria 5610032
212 2753269157 2751185782 Bacteria 11227053
213 2842890648 2842888712 Bacteria 4279094
214 2857732808 2857729791 Bacteria 4040535
215 2928122056 2928121344 Bacteria 3972376
216 2966924302 2966921586 Bacteria 3092803
217 Ga0307517_10144383
218 rootH2_10086722
219 Ga0070676_10187283
220 Ga0070680_100299232
221 Ga0070682_101097363
222 Ga0070682_101506007
223 Ga0068868_100255663
224 Ga0070689_101283527
225 Ga0070692_10939930
226 Ga0070668_100000198
227 Ga0070668_100058027
228 Ga0070668_100296822
229 Ga0070668_100372712
230 Ga0070668_102120827
231 Ga0070669_100487473
232 Ga0070669_100547546
233 Ga0070671_100852770
234 Ga0070709_10834670
235 Ga0070713_100678526
236 Ga0070678_100839861
237 Ga0070678_101873776
238 Ga0070681_11623505
239 Ga0068867_101023491
240 Ga0070685_10978464
241 Ga0070685_11612518
242 Ga0070679_100287546
243 Ga0070679_100808254
244 Ga0070665_100311543
245 Ga0070665_100940170
246 Ga0070665_100982738
247 Ga0070665_101140376
248 Ga0070665_101184468
249 Ga0070665_102541439
250 Ga0068855_102607213
251 Ga0070664_101575940
252 Ga0070702_100882095
253 Ga0068859_100359640
254 Ga0068859_102151924
255 Ga0068864_101491796
256 Ga0068861_100175027
257 Ga0068861_100407364
258 Ga0068861_101163021
259 Ga0068870_10789788
260 Ga0068858_100759974
261 Ga0068860_100208266
262 Ga0068860_100340875
263 Ga0068862_100027048
264 Ga0068862_100594298
265 Ga0081539_10167417
266 Ga0097621_101267538
267 Ga0068871_101850082
268 Ga0075434_100285528
269 Ga0075429_101673392
270 Ga0097620_100359625
271 Ga0097620_102151774
272 Ga0105247_10090378
273 Ga0114129_10665248
274 Ga0105242_12270658
275 Ga0105239_11980925
276 Ga0157369_11622111
277 Ga0157369_11622159
278 Ga0157374_11281686
279 Ga0163162_11045129
280 Ga0157372_11881755
281 Ga0157375_10809124
282 Ga0163163_10613847
283 Ga0163163_10667843
284 Ga0182008_10121339
285 Ga0182008_10896847
286 Ga0157379_10085536
287 Ga0157379_12160288
288 Ga0207710_10303718
289 Ga0207643_10057989
290 Ga0207660_11181198
291 Ga0207652_11206334
292 Ga0207681_10497846
293 Ga0207700_10344258
294 Ga0207691_11002346
295 Ga0207689_10159970
296 Ga0207661_10380964
297 Ga0207679_10421289
298 Ga0207679_10546395
299 Ga0207667_11243423
300 Ga0207668_10015342
301 Ga0207668_10434597
302 Ga0207668_10966937
303 Ga0207678_10063173
304 Ga0207641_10587604
305 Ga0207648_10308279
306 Ga0207676_10235990
307 Ga0207676_11242580
308 Ga0207674_11494067
309 Ga0207675_100230163
310 Ga0207675_100502864
311 Ga0207675_102438572
312 Ga0207683_10540048
313 Ga0207683_12018993
314 Ga0268266_10493920
315 Ga0268266_11361458
316 Ga0268266_11639323
317 Ga0268266_11832708
318 Ga0268265_10111041
319 Ga0268265_10676763
320 Ga0268265_10712124
321 Ga0268264_10150789
322 Ga0268264_11161095
323 Ga0268264_11484411
324 Ga0307517_10221833
325 Ga0307517_10314045
326 Ga0307515_10000315
327 Ga0307515_10002303
328 Ga0307515_10057164
329 Ga0307515_10122024
330 Ga0307511_10287612
331 Ga0307512_10016404
332 Ga0307512_10056290
333 Ga0307512_10184413
334 Ga0307512_10366393
335 Ga0307513_10073906
336 Ga0307509_10019557
337 Ga0307509_10123428
338 Ga0307509_10263940
339 Ga0307509_10615050
340 Ga0307509_10857648
341 Ga0307508_10008262
342 Ga0307508_10014199
343 Ga0307508_10048506
344 Ga0307508_10161919
345 Ga0307508_10186568
346 Ga0307508_10603587
347 Ga0307516_10011877
348 Ga0307516_10079685
349 Ga0307516_10122518
350 Ga0307516_10174507
351 Ga0307516_10182754
352 Ga0307516_10389856
353 Ga0307516_10662214
354 Ga0307405_10350327
355 Ga0307405_11308037
356 Ga0307405_12151197
357 Ga0307413_10362292
358 Ga0307410_11423742
359 Ga0326468_10000638
360 Ga0307406_10179703
361 Ga0307406_10630220
362 Ga0307407_10250699
363 Ga0307412_10780310
364 Ga0307409_100007569
365 Ga0307409_100104702
366 Ga0307416_100077563
367 Ga0307414_10368846
368 Ga0307415_101441535
369 Ga0307510_10416507
370 Ga0373930_0048620
371 Ga0373950_0005994
372 Ga0373940_0004636
373 Ga0373951_0000008
374 Ga0373932_0095556
375 Ga0373941_0062533
376 Ga0373942_0000161
377 Ga0373962_0179404
378 Ga0373935_0016701
379 Ga0436364_0899233
380 Ga0451791_1684666
381 Ga0451797_0279864
382 Ga0451797_0769259
383 Ga0451802_1023416
384 Ga0451833_0115020
385 Ga0451841_0251438
386 Ga0451841_1278759
387 Ga0451845_0472487
388 Ga0451843_0303618
389 Ga0451853_0143022
390 Ga0451853_0287877
391 Ga0451853_1872381
392 Ga0451853_2308582
393 Ga0439463_210437
394 Ga0466961_0380233
395 Ga0466963_0380500
396 Ga0466957_0394920
397 Ga0466967_0782888
398 Ga0495638_0266900
399 Ga0495594_0070938
400 Ga0495594_0284266
401 Ga0495632_0064931
402 Ga0495686_0086661
403 Ga0496108_0000168
404 Ga0496120_0383661
405 Ga0496122_0410653
406 Ga0496123_0072872
407 Ga0501042_0020649
408 Ga0501048_0462469
409 Ga0501076_0189553
410 nmdc:mga0n895_793191_c1
411 Ga0500578_0561841
412 Ga0500644_0011452
413 Ga0500646_0080940
414 Ga0500651_0148832
415 Ga0500641_0141848
416 Ga0500641_0292765
417 Ga0500594_0290137
418 Ga0500652_021324
419 Ga0500652_031348
420 Ga0500589_246612
421 Ga0500600_0066654
422 Ga0500616_0004706
423 Ga0500630_144635
424 Ga0500630_191504
425 Ga0500630_275644
426 Ga0500634_0206653
427 2729907865
428 2753269157
429 2842890648
430 2857732808
431 2928122056
432 2966924302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map