F332210

General Info

Members Datasets Scaffolds Average Seq Length
220 160 204 217

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10112103|Ga0105237_101121033
Length 259
Sequence VASALLQNKPEAARVKSYYYLAKSGMLLNLIPKKLFRNKMQQFLDFALHLDTFLLNFIAIYGSWAYLALFLIIFCETGLVITPFLPGDSLLFVAGSIAAQSNAPLAIWPLFILLLIASILGNQVNFLLGRIVGLRFFKGERAWLLNKKHLEDTHRFYERHGGKTIIFARFLPIIRSFAPFVAGIGDMSHQRFTLYNVSSALLWIGSLLACGYFLGSLPWIKNHFSLVIYGIILISLTPPLISFLFHKLGTCRIAKSESL

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
4 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
5 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
6 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
7 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
8 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
9 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
10 2831864461 Roseateles noduli HZ7 Isolate Nodule
11 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
12 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
13 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
14 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
15 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
108 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
109 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
110 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
111 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
112 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
113 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
114 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
115 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.27
Metatranscriptomes 0.45
Isolates 7.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.55
Nodule 1.36
Rhizoplane 0.91
Rhizosphere 81.36
Stem 0
Stem Tuber 0
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10002108 3300003322 Bacteria 31499
2 rootH1_10001320 3300003323 Bacteria 9772
3 Ga0055526_1001259 3300003771 Bacteria 18175
4 Ga0055524_1000334 3300003775 Bacteria 43451
5 Ga0055524_1017154 3300003775 Bacteria 2565
6 Ga0055530_10023449 3300003791 Bacteria 1773
7 Ga0055531_10002362 3300003794 Bacteria 12692
8 Ga0058692_1000034 3300003856 Bacteria 172911
9 Ga0058692_1007650 3300003856 Bacteria 2848
10 Ga0055543_1005057 3300004625 Bacteria 3439
11 Ga0065165_1000006 3300005262 Bacteria 352298
12 Ga0065165_1000197 3300005262 Bacteria 104294
13 Ga0065703_1000222 3300005272 Bacteria 7802
14 Ga0065714_10125068 3300005288 Bacteria 1300
15 Ga0070666_10197753 3300005335 Bacteria 1414
16 Ga0070682_100617525 3300005337 Bacteria 858
17 Ga0068868_100198779 3300005338 Bacteria 1670
18 Ga0070669_100000495 3300005353 Bacteria 29705
19 Ga0070673_100474363 3300005364 Bacteria 1128
20 Ga0070688_100446199 3300005365 Bacteria 966
21 Ga0070714_100006326 3300005435 Bacteria 9131
22 Ga0070713_100040700 3300005436 Bacteria 3780
23 Ga0070705_100340125 3300005440 Bacteria 1090
24 Ga0070700_100206822 3300005441 Bacteria 1382
25 Ga0070694_100474708 3300005444 Bacteria 991
26 Ga0070698_100108027 3300005471 Bacteria 2750
27 Ga0068853_100433783 3300005539 Bacteria 1234
28 Ga0070665_100003661 3300005548 Bacteria 16284
29 Ga0068859_100188372 3300005617 Bacteria 2147
30 Ga0068859_100693361 3300005617 Bacteria 1109
31 Ga0068862_101139895 3300005844 Bacteria 776
32 Ga0075364_10209071 3300006051 Bacteria 1323
33 Ga0075432_10022706 3300006058 Bacteria 2146
34 Ga0070712_100563227 3300006175 Bacteria 961
35 Ga0075362_10146923 3300006177 Bacteria 1129
36 Ga0075370_10340022 3300006353 Bacteria 896
37 Ga0075428_100058728 3300006844 Bacteria 4211
38 Ga0075428_100966651 3300006844 Bacteria 902
39 Ga0075430_100281565 3300006846 Bacteria 1376
40 Ga0097620_100188373 3300006931 Bacteria 2147
41 Ga0097620_100693278 3300006931 Bacteria 1109
42 Ga0099823_1017343 3300006944 Bacteria 7013
43 Ga0079104_1000116 3300006946 Bacteria 114868
44 Ga0105244_10072511 3300009036 Bacteria 1716
45 Ga0105244_10128509 3300009036 Bacteria 1223
46 Ga0105244_10205986 3300009036 Bacteria 926
47 Ga0105240_10006285 3300009093 Bacteria 17475
48 Ga0111539_10013170 3300009094 Bacteria 10341
49 Ga0111539_10243431 3300009094 Bacteria 2094
50 Ga0105247_10022229 3300009101 Bacteria 3819
51 Ga0105247_10165971 3300009101 Bacteria 1465
52 Ga0114129_10033277 3300009147 Bacteria 7285
53 Ga0114129_10039362 3300009147 Bacteria 6665
54 Ga0105243_10000217 3300009148 Bacteria 67171
55 Ga0105237_10112103 3300009545 Bacteria 2720
56 Ga0105238_10000061 3300009551 Bacteria 127766
57 Ga0105249_10197258 3300009553 Bacteria 1968
58 Ga0105246_10001490 3300011119 Bacteria 13899
59 Ga0105246_10379927 3300011119 Bacteria 1167
60 Ga0157319_1000042 3300012497 Bacteria 24218
61 Ga0157373_10111960 3300013100 Bacteria 1919
62 Ga0157370_10005234 3300013104 Bacteria 14592
63 Ga0163161_10389899 3300017792 Bacteria 1115
64 Ga0206356_10431786 3300020070 Bacteria 2425
65 Ga0213872_10061084 3300021361 Bacteria 1704
66 Ga0213876_10003594 3300021384 Bacteria 8820
67 Ga0213871_10003132 3300021441 Bacteria 3147
68 Ga0213871_10049923 3300021441 Bacteria 1144
69 Ga0209673_1022423 3300025273 Bacteria 2179
70 Ga0209564_1000003 3300025295 Bacteria 1585848
71 Ga0209050_1002700 3300025298 Bacteria 14427
72 Ga0209256_1000373 3300025299 Bacteria 71879
73 Ga0209256_1001693 3300025299 Bacteria 21289
74 Ga0209051_1000947 3300025303 Bacteria 28549
75 Ga0209257_1000671 3300025304 Bacteria 53537
76 Ga0209257_1004861 3300025304 Bacteria 9929
77 Ga0207696_1007691 3300025711 Bacteria 4194
78 Ga0207655_1000281 3300025728 Bacteria 77946
79 Ga0207655_1004407 3300025728 Bacteria 9989
80 Ga0207710_10000136 3300025900 Bacteria 86660
81 Ga0207680_10379811 3300025903 Bacteria 996
82 Ga0207643_10359754 3300025908 Bacteria 915
83 Ga0207695_10005364 3300025913 Bacteria 17042
84 Ga0207693_10561281 3300025915 Unclassified 890
85 Ga0207681_10000405 3300025923 Bacteria 29999
86 Ga0207694_10001674 3300025924 Bacteria 18588
87 Ga0207700_10062069 3300025928 Bacteria 2837
88 Ga0207690_10495124 3300025932 Bacteria 988
89 Ga0207706_10078866 3300025933 Bacteria 2896
90 Ga0207686_10013118 3300025934 Bacteria 4577
91 Ga0207686_10405263 3300025934 Bacteria 1040
92 Ga0207709_10000073 3300025935 Bacteria 176109
93 Ga0207651_10017439 3300025960 Bacteria 4244
94 Ga0207712_10190212 3300025961 Bacteria 1619
95 Ga0207708_10269985 3300026075 Bacteria 1376
96 Ga0207675_101093278 3300026118 Bacteria 817
97 Ga0209371_1000091 3300027312 Bacteria 172276
98 Ga0207428_10112498 3300027907 Bacteria 2094
99 Ga0268266_10002900 3300028379 Bacteria 17768
100 Ga0268256_1000080 3300030500 Bacteria 172273
101 Ga0265332_10128530 3300031238 Bacteria 1063
102 Ga0265327_10003120 3300031251 Bacteria 16304
103 Ga0307408_100077409 3300031548 Bacteria 2476
104 Ga0307408_100653065 3300031548 Bacteria 941
105 Ga0307416_101080994 3300032002 Bacteria 906
106 Ga0436364_0355379 3300037853 Unclassified 2776
107 Ga0436365_0874983 3300039437 Bacteria 53988
108 Ga0436360_0279852 3300039438 Unclassified 955
109 Ga0436360_0576937 3300039438 Bacteria 3689
110 Ga0436360_0833421 3300039438 Bacteria 4818
111 Ga0436360_1003193 3300039438 Bacteria 1694
112 Ga0436361_0283447 3300039447 Unclassified 3442
113 Ga0436361_0396891 3300039447 Bacteria 2532
114 Ga0436361_0611511 3300039447 Bacteria 6082
115 Ga0436361_0717910 3300039447 Bacteria 2801
116 Ga0436361_1180770 3300039447 Unclassified 1311
117 Ga0439437_001929 3300042000 Bacteria 2203
118 Ga0439456_010655 3300042013 Bacteria 1901
119 Ga0450911_000003 3300042115 Bacteria 237055
120 Ga0450902_017175 3300042137 Bacteria 1181
121 Ga0450904_000139 3300042139 Bacteria 16042
122 Ga0450910_002799 3300042147 Bacteria 2295
123 Ga0439446_0006099 3300042156 Bacteria 3128
124 Ga0450916_002826 3300042530 Bacteria 1874
125 Ga0450893_0002289 3300042532 Bacteria 2981
126 Ga0451577_0293001 3300042876 Bacteria 1475
127 Ga0451577_0887464 3300042876 Bacteria 803
128 Ga0453684_0002214 3300044712 Bacteria 48332
129 Ga0453684_0016838 3300044712 Bacteria 11381
130 Ga0453684_0037658 3300044712 Bacteria 6635
131 Ga0453684_1025008 3300044712 Bacteria 876
132 Ga0495653_0061808 3300046463 Bacteria 2832
133 Ga0495630_0047310 3300046517 Bacteria 3217
134 Ga0495666_0018476 3300046526 Bacteria 3469
135 Ga0495623_0023667 3300046679 Bacteria 3962
136 Ga0495600_0056860 3300046809 Bacteria 2556
137 Ga0495604_0023633 3300047317 Bacteria 4905
138 Ga0495680_0077754 3300047322 Bacteria 2512
139 Ga0495675_0030431 3300047444 Bacteria 3444
140 Ga0495681_0001565 3300047470 Bacteria 17050
141 Ga0495593_0030391 3300047673 Bacteria 2956
142 Ga0496110_0251161 3300048913 Bacteria 1609
143 Ga0496114_0014201 3300048917 Bacteria 6388
144 Ga0496124_0007287 3300048927 Bacteria 11798
145 Ga0496125_0103792 3300048928 Bacteria 2084
146 Ga0496125_0246215 3300048928 Bacteria 1131
147 Ga0501031_0001325 3300049568 Bacteria 15233
148 Ga0501031_0003352 3300049568 Bacteria 10286
149 Ga0501031_0014918 3300049568 Bacteria 5049
150 Ga0501031_0031226 3300049568 Bacteria 3474
151 Ga0501032_0000904 3300049569 Bacteria 24050
152 Ga0501032_0003376 3300049569 Bacteria 12246
153 Ga0501032_0017338 3300049569 Bacteria 5055
154 Ga0501032_0160277 3300049569 Bacteria 1477
155 Ga0501032_0417081 3300049569 Bacteria 861
156 Ga0501033_0000863 3300049570 Bacteria 27736
157 Ga0501033_0001114 3300049570 Bacteria 24394
158 Ga0501033_0014706 3300049570 Bacteria 5940
159 Ga0501034_0076711 3300049571 Bacteria 3348
160 Ga0501036_0019330 3300049572 Bacteria 5716
161 Ga0501036_0039792 3300049572 Bacteria 3977
162 Ga0501036_0204460 3300049572 Bacteria 1660
163 Ga0501037_0039094 3300049573 Bacteria 3493
164 Ga0501037_0040468 3300049573 Bacteria 3430
165 Ga0501037_0128841 3300049573 Bacteria 1815
166 Ga0501038_0002374 3300049574 Bacteria 17532
167 Ga0501038_0004014 3300049574 Bacteria 13673
168 Ga0501038_0019111 3300049574 Bacteria 6179
169 Ga0501038_0062947 3300049574 Bacteria 3168
170 Ga0501038_0390941 3300049574 Bacteria 1077
171 Ga0501039_0003951 3300049575 Bacteria 11141
172 Ga0501039_0004686 3300049575 Bacteria 10349
173 Ga0501040_0019813 3300049576 Bacteria 4476
174 Ga0501042_0054219 3300049578 Bacteria 2859
175 Ga0501043_0008059 3300049579 Bacteria 8315
176 Ga0501043_0013599 3300049579 Bacteria 6368
177 Ga0501043_0024777 3300049579 Bacteria 4706
178 Ga0501043_0064215 3300049579 Bacteria 2882
179 Ga0501046_0054738 3300049580 Bacteria 3137
180 Ga0501046_0396346 3300049580 Bacteria 997
181 Ga0501047_0113369 3300049581 Bacteria 2593
182 Ga0501048_0016039 3300049582 Bacteria 5524
183 Ga0501068_0004665 3300049584 Bacteria 7460
184 Ga0501069_0024380 3300049585 Bacteria 3299
185 Ga0501070_0028039 3300049586 Bacteria 4722
186 Ga0501074_0005875 3300049590 Bacteria 8851
187 Ga0501077_0191630 3300049593 Bacteria 1299
188 Ga0501080_0424268 3300049742 Bacteria 1194
189 Ga0501035_0000743 3300049822 Bacteria 35105
190 Ga0501035_0477462 3300049822 Bacteria 1029
191 Ga0501035_0563905 3300049822 Bacteria 931
192 Ga0501044_0000068 3300049823 Bacteria 126642
193 Ga0501044_0014917 3300049823 Bacteria 8378
194 Ga0501044_0246082 3300049823 Bacteria 1731
195 Ga0501044_0255093 3300049823 Bacteria 1693
196 Ga0501044_0371020 3300049823 Bacteria 1347
197 Ga0501044_0384315 3300049823 Bacteria 1318
198 Ga0501045_0000986 3300049824 Bacteria 18652
199 Ga0501045_0092707 3300049824 Bacteria 2234
200 Ga0501226_000035 3300049853 Bacteria 68083
201 nmdc:mga07m45_139825_c1 3300050496 Bacteria 1402
202 nmdc:mga05p37_292078_c1 3300050507 Bacteria 1940
203 nmdc:mga08y16_110605_c1 3300050511 Bacteria 2861
204 Ga0500622_0004491 3300053156 Bacteria 8739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_101093278 Ga0207675_1010932782 175
2 3300039447 Ga0436361_0283447 Ga0436361_0283447_2573_3235 177
3 3300021441 Ga0213871_10003132 Ga0213871_100031323 185
4 3300039438 Ga0436360_0833421 Ga0436360_0833421_2422_3084 185
5 3300039447 Ga0436361_0396891 Ga0436361_0396891_1629_2291 185
6 3300049822 Ga0501035_0477462 Ga0501035_0477462_20_616 185
7 3300039438 Ga0436360_1003193 Ga0436360_1003193_45_707 186
8 3300011119 Ga0105246_10001490 Ga0105246_1000149016 188
9 3300005440 Ga0070705_100340125 Ga0070705_1003401252 192
10 3300021441 Ga0213871_10049923 Ga0213871_100499231 192
11 3300039438 Ga0436360_0576937 Ga0436360_0576937_729_1391 192
12 3300005441 Ga0070700_100206822 Ga0070700_1002068221 194
13 3300026075 Ga0207708_10269985 Ga0207708_102699852 194
14 3300039447 Ga0436361_1180770 Ga0436361_1180770_274_936 194
15 3300039447 Ga0436361_0717910 Ga0436361_0717910_1788_2450 195
16 3300021361 Ga0213872_10061084 Ga0213872_100610841 202
17 3300039438 Ga0436360_0279852 Ga0436360_0279852_14_676 202
18 3300039447 Ga0436361_0611511 Ga0436361_0611511_4658_5320 202
19 3300005288 Ga0065714_10125068 Ga0065714_101250682 205
20 3300005539 Ga0068853_100433783 Ga0068853_1004337831 205
21 3300006051 Ga0075364_10209071 Ga0075364_102090712 205
22 3300006058 Ga0075432_10022706 Ga0075432_100227062 205
23 3300006177 Ga0075362_10146923 Ga0075362_101469232 205
24 3300006946 Ga0079104_1000116 Ga0079104_1000116110 205
25 3300009036 Ga0105244_10128509 Ga0105244_101285092 205
26 3300017792 Ga0163161_10389899 Ga0163161_103898992 205
27 3300042147 Ga0450910_002799 Ga0450910_002799_929_1585 205
28 3300046463 Ga0495653_0061808 Ga0495653_0061808_587_1243 205
29 3300046517 Ga0495630_0047310 Ga0495630_0047310_649_1305 205
30 3300046526 Ga0495666_0018476 Ga0495666_0018476_969_1625 205
31 3300046679 Ga0495623_0023667 Ga0495623_0023667_2267_2923 205
32 3300046809 Ga0495600_0056860 Ga0495600_0056860_498_1154 205
33 3300047317 Ga0495604_0023633 Ga0495604_0023633_701_1357 205
34 3300047322 Ga0495680_0077754 Ga0495680_0077754_484_1140 205
35 3300047444 Ga0495675_0030431 Ga0495675_0030431_1051_1707 205
36 3300047470 Ga0495681_0001565 Ga0495681_0001565_15416_16072 205
37 3300047673 Ga0495593_0030391 Ga0495593_0030391_408_1064 205
38 iso_pu_bacteria 2639762793 2640736382 205
39 iso_pu_bacteria 2675903507 2678229612 205
40 iso_pu_bacteria 2744054655 2745159478 205
41 iso_pu_bacteria 2773857761 2774391181 205
42 iso_pu_bacteria 2773857770 2774439626 205
43 iso_pu_bacteria 2919182534 2919185890 205
44 3300005337 Ga0070682_100617525 Ga0070682_1006175251 206
45 3300031548 Ga0307408_100653065 Ga0307408_1006530652 206
46 3300049573 Ga0501037_0128841 Ga0501037_0128841_1011_1670 206
47 3300049593 Ga0501077_0191630 Ga0501077_0191630_63_722 206
48 3300049823 Ga0501044_0246082 Ga0501044_0246082_894_1553 206
49 iso_pu_bacteria 2511231026 2511383876 206
50 iso_pu_bacteria 2521172590 2521559393 206
51 3300005444 Ga0070694_100474708 Ga0070694_1004747082 207
52 3300037853 Ga0436364_0355379 Ga0436364_0355379_1163_1825 207
53 3300005436 Ga0070713_100040700 Ga0070713_1000407003 208
54 3300006175 Ga0070712_100563227 Ga0070712_1005632271 208
55 3300009553 Ga0105249_10197258 Ga0105249_101972582 208
56 3300020070 Ga0206356_10431786 Ga0206356_104317863 208
57 3300025915 Ga0207693_10561281 Ga0207693_105612811 208
58 3300025928 Ga0207700_10062069 Ga0207700_100620692 208
59 3300025961 Ga0207712_10190212 Ga0207712_101902122 208
60 iso_pu_bacteria 2808606373 2808906298 208
61 iso_pu_bacteria 639633007 639786041 208
62 3300003856 Ga0058692_1000034 Ga0058692_1000034131 209
63 3300005272 Ga0065703_1000222 Ga0065703_10002225 209
64 3300005335 Ga0070666_10197753 Ga0070666_101977532 209
65 3300005353 Ga0070669_100000495 Ga0070669_10000049514 209
66 3300005364 Ga0070673_100474363 Ga0070673_1004743631 209
67 3300005548 Ga0070665_100003661 Ga0070665_10000366110 209
68 3300009036 Ga0105244_10072511 Ga0105244_100725111 209
69 3300009036 Ga0105244_10205986 Ga0105244_102059861 209
70 3300009093 Ga0105240_10006285 Ga0105240_1000628515 209
71 3300009101 Ga0105247_10022229 Ga0105247_100222291 209
72 3300009101 Ga0105247_10165971 Ga0105247_101659712 209
73 3300009148 Ga0105243_10000217 Ga0105243_1000021744 209
74 3300025711 Ga0207696_1007691 Ga0207696_10076914 209
75 3300025728 Ga0207655_1000281 Ga0207655_10002813 209
76 3300025728 Ga0207655_1004407 Ga0207655_10044073 209
77 3300025900 Ga0207710_10000136 Ga0207710_1000013642 209
78 3300025903 Ga0207680_10379811 Ga0207680_103798111 209
79 3300025913 Ga0207695_10005364 Ga0207695_100053643 209
80 3300025923 Ga0207681_10000405 Ga0207681_1000040513 209
81 3300025934 Ga0207686_10405263 Ga0207686_104052632 209
82 3300025935 Ga0207709_10000073 Ga0207709_1000007344 209
83 3300025960 Ga0207651_10017439 Ga0207651_100174392 209
84 3300027312 Ga0209371_1000091 Ga0209371_1000091123 209
85 3300028379 Ga0268266_10002900 Ga0268266_1000290012 209
86 3300030500 Ga0268256_1000080 Ga0268256_1000080123 209
87 3300005617 Ga0068859_100188372 Ga0068859_1001883722 210
88 3300005617 Ga0068859_100693361 Ga0068859_1006933611 210
89 3300005844 Ga0068862_101139895 Ga0068862_1011398951 210
90 3300006844 Ga0075428_100058728 Ga0075428_1000587284 210
91 3300006844 Ga0075428_100966651 Ga0075428_1009666511 210
92 3300006931 Ga0097620_100188373 Ga0097620_1001883732 210
93 3300006931 Ga0097620_100693278 Ga0097620_1006932781 210
94 3300009551 Ga0105238_10000061 Ga0105238_1000006178 210
95 3300025908 Ga0207643_10359754 Ga0207643_103597542 210
96 3300025924 Ga0207694_10001674 Ga0207694_100016742 210
97 iso_pu_bacteria 2547132103 2547375745 210
98 iso_pu_bacteria 2843690924 2843692262 210
99 iso_pu_bacteria 3007315729 3007320035 210
100 3300005365 Ga0070688_100446199 Ga0070688_1004461992 211
101 3300049585 Ga0501069_0024380 Ga0501069_0024380_289_933 211
102 3300049586 Ga0501070_0028039 Ga0501070_0028039_3607_4251 211
103 3300049590 Ga0501074_0005875 Ga0501074_0005875_2162_2806 211
104 3300049742 Ga0501080_0424268 Ga0501080_0424268_374_1018 211
105 iso_pu_bacteria 2831864461 2831864926 211
106 3300005471 Ga0070698_100108027 Ga0070698_1001080274 212
107 3300006846 Ga0075430_100281565 Ga0075430_1002815653 212
108 3300009147 Ga0114129_10039362 Ga0114129_100393624 212
109 3300042013 Ga0439456_010655 Ga0439456_010655_980_1627 212
110 3300042137 Ga0450902_017175 Ga0450902_017175_212_859 212
111 3300048928 Ga0496125_0246215 Ga0496125_0246215_449_1102 212
112 3300031251 Ga0265327_10003120 Ga0265327_100031201 213
113 3300032002 Ga0307416_101080994 Ga0307416_1010809942 213
114 3300042000 Ga0439437_001929 Ga0439437_001929_193_843 213
115 3300042115 Ga0450911_000003 Ga0450911_000003_105085_105735 213
116 3300042139 Ga0450904_000139 Ga0450904_000139_6649_7299 213
117 3300042156 Ga0439446_0006099 Ga0439446_0006099_2222_2872 213
118 3300042532 Ga0450893_0002289 Ga0450893_0002289_1360_2010 213
119 3300042876 Ga0451577_0293001 Ga0451577_0293001_497_1162 213
120 3300044712 Ga0453684_0002214 Ga0453684_0002214_2023_2688 213
121 3300044712 Ga0453684_1025008 Ga0453684_1025008_37_702 213
122 iso_pu_bacteria 2886848708 2886853461 213
123 3300003856 Ga0058692_1007650 Ga0058692_10076503 214
124 3300005338 Ga0068868_100198779 Ga0068868_1001987792 214
125 3300005435 Ga0070714_100006326 Ga0070714_1000063266 214
126 3300009094 Ga0111539_10013170 Ga0111539_100131703 214
127 3300009094 Ga0111539_10243431 Ga0111539_102434312 214
128 3300009545 Ga0105237_10112103 Ga0105237_101121033 214
129 3300011119 Ga0105246_10379927 Ga0105246_103799271 214
130 3300013100 Ga0157373_10111960 Ga0157373_101119602 214
131 3300013104 Ga0157370_10005234 Ga0157370_100052345 214
132 3300021384 Ga0213876_10003594 Ga0213876_100035947 214
133 3300025932 Ga0207690_10495124 Ga0207690_104951242 214
134 3300025933 Ga0207706_10078866 Ga0207706_100788663 214
135 3300027907 Ga0207428_10112498 Ga0207428_101124981 214
136 3300031238 Ga0265332_10128530 Ga0265332_101285302 214
137 3300039437 Ga0436365_0874983 Ga0436365_0874983_35387_36049 214
138 3300042530 Ga0450916_002826 Ga0450916_002826_1179_1835 214
139 3300042876 Ga0451577_0887464 Ga0451577_0887464_13_669 214
140 3300044712 Ga0453684_0016838 Ga0453684_0016838_8717_9373 214
141 3300044712 Ga0453684_0037658 Ga0453684_0037658_823_1476 214
142 3300048917 Ga0496114_0014201 Ga0496114_0014201_1598_2299 214
143 3300049568 Ga0501031_0003352 Ga0501031_0003352_2626_3306 214
144 3300049568 Ga0501031_0014918 Ga0501031_0014918_1908_2582 214
145 3300049568 Ga0501031_0031226 Ga0501031_0031226_1907_2581 214
146 3300049569 Ga0501032_0000904 Ga0501032_0000904_5844_6518 214
147 3300049569 Ga0501032_0003376 Ga0501032_0003376_2761_3441 214
148 3300049569 Ga0501032_0017338 Ga0501032_0017338_2474_3148 214
149 3300049569 Ga0501032_0160277 Ga0501032_0160277_365_1039 214
150 3300049569 Ga0501032_0417081 Ga0501032_0417081_128_808 214
151 3300049570 Ga0501033_0000863 Ga0501033_0000863_6723_7403 214
152 3300049570 Ga0501033_0001114 Ga0501033_0001114_4013_4693 214
153 3300049570 Ga0501033_0014706 Ga0501033_0014706_1371_2045 214
154 3300049571 Ga0501034_0076711 Ga0501034_0076711_894_1568 214
155 3300049572 Ga0501036_0019330 Ga0501036_0019330_2010_2690 214
156 3300049572 Ga0501036_0039792 Ga0501036_0039792_1440_2114 214
157 3300049572 Ga0501036_0204460 Ga0501036_0204460_327_1007 214
158 3300049573 Ga0501037_0039094 Ga0501037_0039094_363_1037 214
159 3300049573 Ga0501037_0040468 Ga0501037_0040468_1812_2492 214
160 3300049574 Ga0501038_0002374 Ga0501038_0002374_3416_4096 214
161 3300049574 Ga0501038_0004014 Ga0501038_0004014_10280_10954 214
162 3300049574 Ga0501038_0019111 Ga0501038_0019111_3182_3856 214
163 3300049574 Ga0501038_0062947 Ga0501038_0062947_2289_2969 214
164 3300049574 Ga0501038_0390941 Ga0501038_0390941_271_951 214
165 3300049575 Ga0501039_0003951 Ga0501039_0003951_3120_3794 214
166 3300049575 Ga0501039_0004686 Ga0501039_0004686_3135_3815 214
167 3300049576 Ga0501040_0019813 Ga0501040_0019813_1359_2033 214
168 3300049578 Ga0501042_0054219 Ga0501042_0054219_155_829 214
169 3300049579 Ga0501043_0008059 Ga0501043_0008059_2474_3148 214
170 3300049579 Ga0501043_0013599 Ga0501043_0013599_1523_2203 214
171 3300049579 Ga0501043_0024777 Ga0501043_0024777_2133_2813 214
172 3300049579 Ga0501043_0064215 Ga0501043_0064215_473_1147 214
173 3300049580 Ga0501046_0054738 Ga0501046_0054738_1458_2138 214
174 3300049580 Ga0501046_0396346 Ga0501046_0396346_46_720 214
175 3300049581 Ga0501047_0113369 Ga0501047_0113369_1309_1983 214
176 3300049582 Ga0501048_0016039 Ga0501048_0016039_3264_3938 214
177 3300049584 Ga0501068_0004665 Ga0501068_0004665_2643_3317 214
178 3300049822 Ga0501035_0000743 Ga0501035_0000743_7772_8452 214
179 3300049822 Ga0501035_0563905 Ga0501035_0563905_194_874 214
180 3300049823 Ga0501044_0000068 Ga0501044_0000068_55266_55946 214
181 3300049823 Ga0501044_0014917 Ga0501044_0014917_409_1089 214
182 3300049823 Ga0501044_0255093 Ga0501044_0255093_720_1400 214
183 3300049823 Ga0501044_0371020 Ga0501044_0371020_345_1019 214
184 3300049823 Ga0501044_0384315 Ga0501044_0384315_315_989 214
185 3300049824 Ga0501045_0000986 Ga0501045_0000986_14996_15670 214
186 3300049824 Ga0501045_0092707 Ga0501045_0092707_696_1376 214
187 3300049853 Ga0501226_000035 Ga0501226_000035_15686_16342 214
188 3300050511 nmdc:mga08y16_110605_c1 nmdc:mga08y16_110605_c1_1359_2060 214
189 iso_pu_bacteria 2891633521 2891636748 214
190 3300003323 rootH1_10001320 rootH1_100013206 215
191 3300003771 Ga0055526_1001259 Ga0055526_10012593 215
192 3300003775 Ga0055524_1017154 Ga0055524_10171542 215
193 3300003791 Ga0055530_10023449 Ga0055530_100234491 215
194 3300005262 Ga0065165_1000197 Ga0065165_100019759 215
195 3300006944 Ga0099823_1017343 Ga0099823_10173434 215
196 3300025273 Ga0209673_1022423 Ga0209673_10224234 215
197 3300025295 Ga0209564_1000003 Ga0209564_10000031105 215
198 3300025298 Ga0209050_1002700 Ga0209050_100270012 215
199 3300025299 Ga0209256_1001693 Ga0209256_10016933 215
200 3300025303 Ga0209051_1000947 Ga0209051_100094716 215
201 3300025304 Ga0209257_1004861 Ga0209257_10048616 215
202 3300048927 Ga0496124_0007287 Ga0496124_0007287_6001_6648 215
203 3300049568 Ga0501031_0001325 Ga0501031_0001325_10632_11279 215
204 3300004625 Ga0055543_1005057 Ga0055543_10050572 216
205 3300005262 Ga0065165_1000006 Ga0065165_10000062 216
206 3300009147 Ga0114129_10033277 Ga0114129_100332779 216
207 3300048913 Ga0496110_0251161 Ga0496110_0251161_762_1460 216
208 3300050507 nmdc:mga05p37_292078_c1 nmdc:mga05p37_292078_c1_905_1579 216
209 3300053156 Ga0500622_0004491 Ga0500622_0004491_2362_3012 216
210 3300003322 rootL2_10002108 rootL2_1000210823 217
211 3300003775 Ga0055524_1000334 Ga0055524_100033414 217
212 3300003794 Ga0055531_10002362 Ga0055531_1000236212 217
213 3300006353 Ga0075370_10340022 Ga0075370_103400222 217
214 3300012497 Ga0157319_1000042 Ga0157319_100004216 217
215 3300025299 Ga0209256_1000373 Ga0209256_100037325 217
216 3300025304 Ga0209257_1000671 Ga0209257_100067126 217
217 3300025934 Ga0207686_10013118 Ga0207686_100131186 217
218 3300031548 Ga0307408_100077409 Ga0307408_1000774092 217
219 3300048928 Ga0496125_0103792 Ga0496125_0103792_862_1539 217
220 3300050496 nmdc:mga07m45_139825_c1 nmdc:mga07m45_139825_c1_566_1219 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

85

213

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3te0-assembly1.cif.gz_C crystal structure of hsc k148e 0.3613 52 189
7w7r-assembly1.cif.gz_C-2 high resolution structure of a fish aquaporin reveals a novel extracellular fold. 0.3273 55 181
3te1-assembly1.cif.gz_B crystal structure of hsc t84a 0.3198 52 190
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.278 30 203
8bxg-assembly1.cif.gz_A structure of the k/h exchanger kefc. 0.2511 52 200
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8303 52 173 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7917 52 173 1.10.1760.20
af_Q54QN5_17_278_1.20.190.10 Mainly Alpha;Up-down Bundle;Delta-Endotoxin; domain 1;Pesticidal crystal protein, N-terminal domain 0.3954 67 175 1.20.190.10
af_P9WJX3_18_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3356 52 202 1.20.1250.20
af_A0A0R0GV15_321_483_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3296 5 188 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6A5L009-F1-model_v4 deleted 0.9502 1 211
AF-R1GRF2-F1-model_v4 DedA protein 0.9384 8 199 GO:0005886
AF-A0A847VL85-F1-model_v4 VTT domain-containing protein 0.926 8 211 GO:0005886
AF-A0A0G4JXQ0-F1-model_v4 DedA protein 0.9221 1 211 GO:0005886
AF-A0A0F9ZLL1-F1-model_v4 VTT domain-containing protein 0.9218 1 210 GO:0005886

Feature Viewer

pLDDT pTM Quality
72.83 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map