F332071

General Info

Members Datasets Scaffolds Average Seq Length
220 144 440 155

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10002333|Ga0070717_100023338
Length 174
Sequence MSRAAKIDSLRVIELPRKLSHYDQSGRARMVDVSGKSATVREAEASALVVMAPAVLKSLDNNPKGNPLEIARLAGIMAAKKTAELIPLCHSLPLSHIDVELRQCENGVAISSSVRTTAETGVEMEALVAASIAALTVYDMCKALDKGIEIREVVLQRKSGGKSGDYMRKKSHAE

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
89 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
103 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 1.36
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.18
Rhizosphere 96.82
Stem 0
Stem Tuber 0
Unclassified 11.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10002333 3300006028 Bacteria 13356
2 Ga0065715_10143467 3300005293 Bacteria 1820
3 Ga0065707_10139070 3300005295 Unclassified 1797
4 Ga0070658_10297146 3300005327 Bacteria 1377
5 Ga0070690_100679202 3300005330 Bacteria 789
6 Ga0070682_100591294 3300005337 Bacteria 875
7 Ga0070660_100043900 3300005339 Bacteria 3417
8 Ga0070709_10013992 3300005434 Bacteria 4527
9 Ga0070714_100833370 3300005435 Bacteria 894
10 Ga0070714_100973049 3300005435 Bacteria 825
11 Ga0070713_100020027 3300005436 Bacteria 5121
12 Ga0070710_10007913 3300005437 Bacteria 5165
13 Ga0070710_10554346 3300005437 Unclassified 794
14 Ga0070710_10664490 3300005437 Bacteria 732
15 Ga0070711_100000015 3300005439 Bacteria 154719
16 Ga0070711_100017717 3300005439 Bacteria 4538
17 Ga0070705_100041103 3300005440 Bacteria 2634
18 Ga0070708_100012329 3300005445 Bacteria 6972
19 Ga0070708_100233787 3300005445 Bacteria 1725
20 Ga0070663_100844130 3300005455 Bacteria 788
21 Ga0070681_10211771 3300005458 Unclassified 1854
22 Ga0070681_10785400 3300005458 Bacteria 869
23 Ga0070706_100047159 3300005467 Bacteria 3976
24 Ga0070706_100134508 3300005467 Bacteria 2308
25 Ga0070706_100152685 3300005467 Bacteria 2156
26 Ga0070707_100042332 3300005468 Bacteria 4361
27 Ga0070707_100246014 3300005468 Bacteria 1740
28 Ga0070698_100186491 3300005471 Bacteria 2012
29 Ga0070699_100072359 3300005518 Unclassified 2999
30 Ga0070679_100053199 3300005530 Bacteria 4030
31 Ga0070679_100331942 3300005530 Bacteria 1469
32 Ga0070684_100251921 3300005535 Bacteria 1614
33 Ga0070697_100003688 3300005536 Bacteria 11775
34 Ga0070697_100075116 3300005536 Bacteria 2777
35 Ga0068855_100256643 3300005563 Unclassified 1949
36 Ga0068856_100125440 3300005614 Bacteria 2570
37 Ga0068863_100829675 3300005841 Bacteria 923
38 Ga0081540_1356144 3300005983 Bacteria 500
39 Ga0081539_10113453 3300005985 Bacteria 1359
40 Ga0070717_10047451 3300006028 Bacteria 3519
41 Ga0070717_11587545 3300006028 Unclassified 593
42 Ga0070715_10371990 3300006163 Bacteria 786
43 Ga0070716_100000157 3300006173 Bacteria 27050
44 Ga0070712_100027284 3300006175 Bacteria 3812
45 Ga0070712_100064943 3300006175 Bacteria 2589
46 Ga0070712_100218557 3300006175 Unclassified 1507
47 Ga0070712_100844072 3300006175 Bacteria 788
48 Ga0068871_100193704 3300006358 Unclassified 1752
49 Ga0075433_10839302 3300006852 Bacteria 802
50 Ga0075434_100203715 3300006871 Bacteria 1999
51 Ga0075436_100012387 3300006914 Bacteria 5847
52 Ga0075436_100661241 3300006914 Bacteria 772
53 Ga0105240_10127886 3300009093 Unclassified 3050
54 Ga0111539_10054996 3300009094 Bacteria 4733
55 Ga0114129_10061949 3300009147 Bacteria 5227
56 Ga0105241_10008092 3300009174 Bacteria 7735
57 Ga0105237_10031397 3300009545 Bacteria 5387
58 Ga0105237_10570457 3300009545 Bacteria 1138
59 Ga0105237_10739806 3300009545 Bacteria 990
60 Ga0105238_10247529 3300009551 Unclassified 1760
61 Ga0105238_11315478 3300009551 Unclassified 749
62 Ga0157373_10034997 3300013100 Bacteria 3607
63 Ga0157370_10084218 3300013104 Unclassified 2989
64 Ga0157369_10006707 3300013105 Bacteria 13289
65 Ga0157369_10017940 3300013105 Bacteria 7946
66 Ga0157369_10765005 3300013105 Bacteria 993
67 Ga0157374_10184080 3300013296 Bacteria 2042
68 Ga0157378_10336973 3300013297 Bacteria 1470
69 Ga0157372_10000867 3300013307 Bacteria 32838
70 Ga0157372_10002713 3300013307 Bacteria 19156
71 Ga0163163_10622580 3300014325 Unclassified 1143
72 Ga0163163_11449135 3300014325 Bacteria 748
73 Ga0157380_10623512 3300014326 Unclassified 1071
74 Ga0157376_10031445 3300014969 Bacteria 4250
75 Ga0206354_11051393 3300020081 Bacteria 871
76 Ga0207692_10205789 3300025898 Bacteria 1159
77 Ga0207692_10512764 3300025898 Bacteria 762
78 Ga0207699_10077897 3300025906 Bacteria 2047
79 Ga0207699_10086539 3300025906 Bacteria 1957
80 Ga0207705_10117805 3300025909 Bacteria 1968
81 Ga0207684_11005921 3300025910 Bacteria 697
82 Ga0207654_10016150 3300025911 Bacteria 3884
83 Ga0207695_10096402 3300025913 Unclassified 2960
84 Ga0207695_11245911 3300025913 Unclassified 624
85 Ga0207671_10297016 3300025914 Bacteria 1276
86 Ga0207693_10050639 3300025915 Unclassified 3260
87 Ga0207693_10077845 3300025915 Bacteria 2596
88 Ga0207693_10726453 3300025915 Bacteria 768
89 Ga0207663_10000016 3300025916 Bacteria 147239
90 Ga0207663_10254460 3300025916 Bacteria 1294
91 Ga0207663_10480046 3300025916 Bacteria 963
92 Ga0207660_10754375 3300025917 Bacteria 794
93 Ga0207657_10002761 3300025919 Bacteria 18903
94 Ga0207652_10383610 3300025921 Bacteria 1268
95 Ga0207652_10553456 3300025921 Bacteria 1034
96 Ga0207646_10087246 3300025922 Bacteria 2792
97 Ga0207646_10602446 3300025922 Bacteria 986
98 Ga0207646_11147606 3300025922 Bacteria 683
99 Ga0207694_10238481 3300025924 Unclassified 1486
100 Ga0207700_10428853 3300025928 Bacteria 1162
101 Ga0207700_11445713 3300025928 Bacteria 611
102 Ga0207665_10000085 3300025939 Bacteria 60799
103 Ga0207665_10049602 3300025939 Bacteria 2821
104 Ga0207661_11094420 3300025944 Bacteria 734
105 Ga0207667_11633695 3300025949 Unclassified 612
106 Ga0207678_10881798 3300026067 Bacteria 791
107 Ga0207641_10526439 3300026088 Bacteria 1150
108 Ga0207428_10078412 3300027907 Unclassified 2584
109 Ga0265356_1003712 3300028017 Bacteria 1906
110 Ga0268266_10043514 3300028379 Bacteria 3838
111 Ga0268266_11488326 3300028379 Bacteria 652
112 Ga0265319_1004222 3300028563 Bacteria 7185
113 Ga0265319_1025641 3300028563 Bacteria 2108
114 Ga0265318_10046616 3300028577 Bacteria 1636
115 Ga0265338_10153586 3300028800 Bacteria 1786
116 Ga0265338_10825881 3300028800 Bacteria 634
117 Ga0265324_10162188 3300029957 Bacteria 759
118 Ga0265762_1004406 3300030760 Bacteria 2523
119 Ga0265760_10075706 3300031090 Bacteria 1037
120 Ga0265320_10000130 3300031240 Bacteria 65406
121 Ga0265339_10168660 3300031249 Bacteria 1097
122 Ga0265316_10583370 3300031344 Bacteria 794
123 Ga0316576_10717831 3300031727 Bacteria 723
124 Ga0307405_10244741 3300031731 Bacteria 1331
125 Ga0307415_100136542 3300032126 Bacteria 1866
126 Ga0373923_0036877 3300035111 Bacteria 1998
127 Ga0373960_0059703 3300035121 Bacteria 1154
128 Ga0373942_0287066 3300035207 Unclassified 568
129 Ga0373927_0311582 3300035695 Bacteria 1036
130 Ga0373925_0002735 3300037068 Bacteria 13954
131 Ga0373925_0094916 3300037068 Bacteria 2284
132 Ga0373925_0183872 3300037068 Bacteria 1656
133 Ga0395899_0180726 3300037312 Bacteria 1481
134 Ga0395899_0223264 3300037312 Bacteria 1304
135 Ga0395899_0799921 3300037312 Unclassified 583
136 Ga0395900_0015636 3300037418 Bacteria 7736
137 Ga0395900_0015785 3300037418 Bacteria 7700
138 Ga0395900_0086106 3300037418 Bacteria 3229
139 Ga0395900_0151288 3300037418 Bacteria 2371
140 Ga0395900_0209128 3300037418 Bacteria 1971
141 Ga0395898_0285116 3300037466 Bacteria 1575
142 Ga0395898_0393589 3300037466 Bacteria 1321
143 Ga0395898_0530027 3300037466 Bacteria 1119
144 Ga0395905_0052250 3300037471 Bacteria 3826
145 Ga0395905_0315469 3300037471 Bacteria 1452
146 Ga0395901_0026918 3300038443 Bacteria 5904
147 Ga0395901_0026921 3300038443 Bacteria 5904
148 Ga0395901_0065216 3300038443 Bacteria 3791
149 Ga0395901_0097179 3300038443 Bacteria 3087
150 Ga0395901_0586374 3300038443 Bacteria 1126
151 Ga0395901_1368318 3300038443 Bacteria 667
152 Ga0466957_1090616 3300044842 Bacteria 575
153 Ga0451576_0243806 3300045051 Bacteria 1877
154 Ga0451576_1130289 3300045051 Bacteria 819
155 Ga0495629_0796058 3300046459 Bacteria 624
156 Ga0495580_0303064 3300046472 Bacteria 1088
157 Ga0495639_0408302 3300046475 Bacteria 687
158 Ga0495596_0114635 3300046500 Bacteria 1047
159 Ga0495669_0093934 3300046684 Bacteria 1388
160 Ga0495672_0018503 3300047320 Bacteria 4620
161 Ga0495602_0022569 3300048088 Bacteria 6157
162 Ga0495602_0330840 3300048088 Bacteria 1105
163 Ga0496102_0011843 3300048905 Bacteria 7528
164 Ga0496103_0177971 3300048906 Bacteria 1367
165 Ga0496106_0071115 3300048909 Unclassified 2659
166 Ga0496110_0656839 3300048913 Bacteria 949
167 Ga0496112_0122853 3300048915 Bacteria 2567
168 Ga0496112_0800534 3300048915 Bacteria 867
169 Ga0496113_0537116 3300048916 Unclassified 938
170 Ga0501031_0006818 3300049568 Bacteria 7454
171 Ga0501031_0018127 3300049568 Bacteria 4581
172 Ga0501032_0003762 3300049569 Bacteria 11515
173 Ga0501032_0412003 3300049569 Bacteria 867
174 Ga0501033_0009452 3300049570 Bacteria 7506
175 Ga0501033_0102701 3300049570 Bacteria 2085
176 Ga0501034_0001721 3300049571 Bacteria 28163
177 Ga0501034_0154598 3300049571 Bacteria 2268
178 Ga0501034_0875066 3300049571 Bacteria 787
179 Ga0501036_0000060 3300049572 Bacteria 72151
180 Ga0501036_0078266 3300049572 Bacteria 2797
181 Ga0501037_0001585 3300049573 Bacteria 16541
182 Ga0501037_0024735 3300049573 Bacteria 4441
183 Ga0501037_1140085 3300049573 Bacteria 504
184 Ga0501038_0015897 3300049574 Bacteria 6837
185 Ga0501039_0080239 3300049575 Bacteria 2539
186 Ga0501040_0019990 3300049576 Bacteria 4459
187 Ga0501041_0072340 3300049577 Bacteria 2118
188 Ga0501043_0001737 3300049579 Bacteria 18821
189 Ga0501043_0222874 3300049579 Bacteria 1458
190 Ga0501043_0534386 3300049579 Bacteria 873
191 Ga0501046_0001981 3300049580 Bacteria 19460
192 Ga0501046_0125201 3300049580 Bacteria 1953
193 Ga0501046_0736386 3300049580 Bacteria 693
194 Ga0501047_0008157 3300049581 Bacteria 9888
195 Ga0501047_0013323 3300049581 Bacteria 7789
196 Ga0501048_0135367 3300049582 Bacteria 1741
197 Ga0501067_0017336 3300049583 Bacteria 3980
198 Ga0501068_0167639 3300049584 Bacteria 1385
199 Ga0501069_0008652 3300049585 Bacteria 5359
200 Ga0501070_0006472 3300049586 Bacteria 9970
201 Ga0501074_0021705 3300049590 Bacteria 4661
202 Ga0501077_0515310 3300049593 Bacteria 767
203 Ga0501079_0013496 3300049741 Bacteria 6229
204 Ga0501079_0327698 3300049741 Bacteria 1199
205 Ga0501080_0030100 3300049742 Bacteria 5056
206 Ga0501081_0068442 3300049743 Bacteria 2472
207 Ga0501035_0010048 3300049822 Bacteria 8783
208 Ga0501035_0012872 3300049822 Bacteria 7724
209 Ga0501044_0002730 3300049823 Bacteria 20083
210 Ga0501044_0005208 3300049823 Bacteria 14476
211 nmdc:mga05p37_64876_c1 3300050507 Unclassified 4493
212 nmdc:mga08y16_60931_c1 3300050511 Unclassified 3940
213 nmdc:mga0n895_85929_c1 3300050512 Bacteria 3141
214 nmdc:mga08x19_100419_c1 3300050514 Bacteria 1919
215 nmdc:mga08x19_32_c1 3300050514 Bacteria 203770
216 nmdc:mga0a205_174092_c1 3300050515 Bacteria 2048
217 Ga0501084_0016608 3300054114 Bacteria 6112
218 Ga0501084_0331285 3300054114 Bacteria 1286
219 Ga0501082_0042569 3300060353 Bacteria 3915
220 2887377583 2887375801 Bacteria 5334027
221 Ga0070717_10002333
222 Ga0065715_10143467
223 Ga0065707_10139070
224 Ga0070658_10297146
225 Ga0070690_100679202
226 Ga0070682_100591294
227 Ga0070660_100043900
228 Ga0070709_10013992
229 Ga0070714_100833370
230 Ga0070714_100973049
231 Ga0070713_100020027
232 Ga0070710_10007913
233 Ga0070710_10554346
234 Ga0070710_10664490
235 Ga0070711_100000015
236 Ga0070711_100017717
237 Ga0070705_100041103
238 Ga0070708_100012329
239 Ga0070708_100233787
240 Ga0070663_100844130
241 Ga0070681_10211771
242 Ga0070681_10785400
243 Ga0070706_100047159
244 Ga0070706_100134508
245 Ga0070706_100152685
246 Ga0070707_100042332
247 Ga0070707_100246014
248 Ga0070698_100186491
249 Ga0070699_100072359
250 Ga0070679_100053199
251 Ga0070679_100331942
252 Ga0070684_100251921
253 Ga0070697_100003688
254 Ga0070697_100075116
255 Ga0068855_100256643
256 Ga0068856_100125440
257 Ga0068863_100829675
258 Ga0081540_1356144
259 Ga0081539_10113453
260 Ga0070717_10047451
261 Ga0070717_11587545
262 Ga0070715_10371990
263 Ga0070716_100000157
264 Ga0070712_100027284
265 Ga0070712_100064943
266 Ga0070712_100218557
267 Ga0070712_100844072
268 Ga0068871_100193704
269 Ga0075433_10839302
270 Ga0075434_100203715
271 Ga0075436_100012387
272 Ga0075436_100661241
273 Ga0105240_10127886
274 Ga0111539_10054996
275 Ga0114129_10061949
276 Ga0105241_10008092
277 Ga0105237_10031397
278 Ga0105237_10570457
279 Ga0105237_10739806
280 Ga0105238_10247529
281 Ga0105238_11315478
282 Ga0157373_10034997
283 Ga0157370_10084218
284 Ga0157369_10006707
285 Ga0157369_10017940
286 Ga0157369_10765005
287 Ga0157374_10184080
288 Ga0157378_10336973
289 Ga0157372_10000867
290 Ga0157372_10002713
291 Ga0163163_10622580
292 Ga0163163_11449135
293 Ga0157380_10623512
294 Ga0157376_10031445
295 Ga0206354_11051393
296 Ga0207692_10205789
297 Ga0207692_10512764
298 Ga0207699_10077897
299 Ga0207699_10086539
300 Ga0207705_10117805
301 Ga0207684_11005921
302 Ga0207654_10016150
303 Ga0207695_10096402
304 Ga0207695_11245911
305 Ga0207671_10297016
306 Ga0207693_10050639
307 Ga0207693_10077845
308 Ga0207693_10726453
309 Ga0207663_10000016
310 Ga0207663_10254460
311 Ga0207663_10480046
312 Ga0207660_10754375
313 Ga0207657_10002761
314 Ga0207652_10383610
315 Ga0207652_10553456
316 Ga0207646_10087246
317 Ga0207646_10602446
318 Ga0207646_11147606
319 Ga0207694_10238481
320 Ga0207700_10428853
321 Ga0207700_11445713
322 Ga0207665_10000085
323 Ga0207665_10049602
324 Ga0207661_11094420
325 Ga0207667_11633695
326 Ga0207678_10881798
327 Ga0207641_10526439
328 Ga0207428_10078412
329 Ga0265356_1003712
330 Ga0268266_10043514
331 Ga0268266_11488326
332 Ga0265319_1004222
333 Ga0265319_1025641
334 Ga0265318_10046616
335 Ga0265338_10153586
336 Ga0265338_10825881
337 Ga0265324_10162188
338 Ga0265762_1004406
339 Ga0265760_10075706
340 Ga0265320_10000130
341 Ga0265339_10168660
342 Ga0265316_10583370
343 Ga0316576_10717831
344 Ga0307405_10244741
345 Ga0307415_100136542
346 Ga0373923_0036877
347 Ga0373960_0059703
348 Ga0373942_0287066
349 Ga0373927_0311582
350 Ga0373925_0002735
351 Ga0373925_0094916
352 Ga0373925_0183872
353 Ga0395899_0180726
354 Ga0395899_0223264
355 Ga0395899_0799921
356 Ga0395900_0015636
357 Ga0395900_0015785
358 Ga0395900_0086106
359 Ga0395900_0151288
360 Ga0395900_0209128
361 Ga0395898_0285116
362 Ga0395898_0393589
363 Ga0395898_0530027
364 Ga0395905_0052250
365 Ga0395905_0315469
366 Ga0395901_0026918
367 Ga0395901_0026921
368 Ga0395901_0065216
369 Ga0395901_0097179
370 Ga0395901_0586374
371 Ga0395901_1368318
372 Ga0466957_1090616
373 Ga0451576_0243806
374 Ga0451576_1130289
375 Ga0495629_0796058
376 Ga0495580_0303064
377 Ga0495639_0408302
378 Ga0495596_0114635
379 Ga0495669_0093934
380 Ga0495672_0018503
381 Ga0495602_0022569
382 Ga0495602_0330840
383 Ga0496102_0011843
384 Ga0496103_0177971
385 Ga0496106_0071115
386 Ga0496110_0656839
387 Ga0496112_0122853
388 Ga0496112_0800534
389 Ga0496113_0537116
390 Ga0501031_0006818
391 Ga0501031_0018127
392 Ga0501032_0003762
393 Ga0501032_0412003
394 Ga0501033_0009452
395 Ga0501033_0102701
396 Ga0501034_0001721
397 Ga0501034_0154598
398 Ga0501034_0875066
399 Ga0501036_0000060
400 Ga0501036_0078266
401 Ga0501037_0001585
402 Ga0501037_0024735
403 Ga0501037_1140085
404 Ga0501038_0015897
405 Ga0501039_0080239
406 Ga0501040_0019990
407 Ga0501041_0072340
408 Ga0501043_0001737
409 Ga0501043_0222874
410 Ga0501043_0534386
411 Ga0501046_0001981
412 Ga0501046_0125201
413 Ga0501046_0736386
414 Ga0501047_0008157
415 Ga0501047_0013323
416 Ga0501048_0135367
417 Ga0501067_0017336
418 Ga0501068_0167639
419 Ga0501069_0008652
420 Ga0501070_0006472
421 Ga0501074_0021705
422 Ga0501077_0515310
423 Ga0501079_0013496
424 Ga0501079_0327698
425 Ga0501080_0030100
426 Ga0501081_0068442
427 Ga0501035_0010048
428 Ga0501035_0012872
429 Ga0501044_0002730
430 Ga0501044_0005208
431 nmdc:mga05p37_64876_c1
432 nmdc:mga08y16_60931_c1
433 nmdc:mga0n895_85929_c1
434 nmdc:mga08x19_100419_c1
435 nmdc:mga08x19_32_c1
436 nmdc:mga0a205_174092_c1
437 Ga0501084_0016608
438 Ga0501084_0331285
439 Ga0501082_0042569
440 2887377583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

30

161

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9814 15 148
2ohd-assembly1.cif.gz_D crystal structure of hypothetical molybdenum cofactor biosynthesis protein c from sulfolobus tokodaii 0.9734 16 147
4fdf-assembly1.cif.gz_A structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9657 14 148
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.9606 18 153
2ekn-assembly1.cif.gz_A structure of ph1811 protein from pyrococcus horikoshii 0.9588 15 152
ID Description Score Start End Superfamily
2ohdB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9717 16 147 3.30.70.640
4fdfA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9657 14 148 3.30.70.640
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9591 6 151 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.953 14 153 3.30.70.640
4pydF00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9442 28 146 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A2V6HT68-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC 1.001 41 153 GO:0006777
GO:0061799
AF-A0A838Q804-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 1 27 153 GO:0006777
GO:0016829
AF-D3DIH0-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9994 18 149 GO:0006777
GO:0061799
AF-A0A432FH18-F1-model_v4 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB 0.9975 18 149 GO:0006777
GO:0061799
AF-A0A1G3L7I4-F1-model_v4 Molybdenum cofactor biosynthesis protein C 0.996 35 153 GO:0006777
GO:0061798
GO:0061799

Map