F331810

General Info

Members Datasets Scaffolds Average Seq Length
220 178 440 69

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10407046|Ga0070676_104070462
Length 73
Sequence MPKLAGVNHLAAIAALLKVGFVVARQGSHVVLKRENDQRILTIPRHNPINAFTMGGIIRDAGLSVDEFKKLLP

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 2904424332 Duganella sp. 1411 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 1.36
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 0.91
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 23.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10407046 3300005328 Bacteria 948
2 Ga0055526_1057519 3300003771 Bacteria 846
3 Ga0055524_1000717 3300003775 Bacteria 22758
4 Ga0070683_100000009 3300005329 Bacteria 319830
5 Ga0070683_102315596 3300005329 Unclassified 515
6 Ga0070670_101260311 3300005331 Unclassified 676
7 Ga0068869_101769547 3300005334 Unclassified 552
8 Ga0070666_11242914 3300005335 Unclassified 555
9 Ga0070680_100253628 3300005336 Bacteria 1488
10 Ga0070680_100638071 3300005336 Bacteria 915
11 Ga0070682_100337035 3300005337 Bacteria 1120
12 Ga0068868_100921484 3300005338 Unclassified 795
13 Ga0070660_101480697 3300005339 Bacteria 577
14 Ga0070692_10638176 3300005345 Bacteria 709
15 Ga0070668_100376805 3300005347 Bacteria 1207
16 Ga0070669_101557031 3300005353 Bacteria 575
17 Ga0070688_100183934 3300005365 Bacteria 1451
18 Ga0070688_101133264 3300005365 Unclassified 626
19 Ga0070659_100047204 3300005366 Bacteria 3377
20 Ga0070694_100739242 3300005444 Bacteria 803
21 Ga0070662_101213350 3300005457 Bacteria 648
22 Ga0070681_10152908 3300005458 Bacteria 2233
23 Ga0070681_10744970 3300005458 Bacteria 896
24 Ga0068867_100630651 3300005459 Bacteria 938
25 Ga0070706_100007471 3300005467 Bacteria 10245
26 Ga0070706_100076674 3300005467 Bacteria 3094
27 Ga0070706_100184531 3300005467 Bacteria 1949
28 Ga0070706_101106792 3300005467 Bacteria 729
29 Ga0070698_100025157 3300005471 Bacteria 6204
30 Ga0070699_100233299 3300005518 Bacteria 1641
31 Ga0070699_100433447 3300005518 Bacteria 1191
32 Ga0070699_101681922 3300005518 Unclassified 581
33 Ga0070684_100000514 3300005535 Bacteria 26609
34 Ga0070684_100036413 3300005535 Bacteria 4216
35 Ga0068853_101075007 3300005539 Bacteria 776
36 Ga0070686_101438901 3300005544 Bacteria 579
37 Ga0070696_100030790 3300005546 Bacteria 3675
38 Ga0070693_100491056 3300005547 Bacteria 869
39 Ga0070693_101356871 3300005547 Unclassified 551
40 Ga0070665_101322933 3300005548 Unclassified 730
41 Ga0070704_101707460 3300005549 Unclassified 582
42 Ga0068855_100508155 3300005563 Bacteria 1309
43 Ga0068855_102445959 3300005563 Bacteria 520
44 Ga0068854_101455273 3300005578 Unclassified 621
45 Ga0068859_101086338 3300005617 Bacteria 880
46 Ga0068864_101846551 3300005618 Bacteria 610
47 Ga0068851_10107916 3300005834 Bacteria 1484
48 Ga0068863_100296443 3300005841 Bacteria 1568
49 Ga0068860_100453492 3300005843 Bacteria 1275
50 Ga0068860_102522144 3300005843 Unclassified 534
51 Ga0068862_100153024 3300005844 Bacteria 2054
52 Ga0068862_100394853 3300005844 Unclassified 1293
53 Ga0097621_100044200 3300006237 Bacteria 3594
54 Ga0097621_100648254 3300006237 Bacteria 969
55 Ga0068871_100276160 3300006358 Bacteria 1469
56 Ga0068871_100846060 3300006358 Bacteria 845
57 Ga0068871_102280627 3300006358 Unclassified 516
58 Ga0075428_100280206 3300006844 Bacteria 1794
59 Ga0075430_100318712 3300006846 Unclassified 1285
60 Ga0075433_10107249 3300006852 Bacteria 2476
61 Ga0075434_100358051 3300006871 Unclassified 1480
62 Ga0075436_100951684 3300006914 Bacteria 643
63 Ga0097620_101086340 3300006931 Bacteria 880
64 Ga0075435_100869065 3300007076 Bacteria 786
65 Ga0099794_10594653 3300007265 Bacteria 586
66 Ga0105240_10145245 3300009093 Bacteria 2831
67 Ga0114129_13236262 3300009147 Unclassified 529
68 Ga0105242_10915916 3300009176 Unclassified 878
69 Ga0105239_11845436 3300010375 Unclassified 701
70 Ga0105246_10529858 3300011119 Bacteria 1006
71 Ga0157373_11017573 3300013100 Bacteria 619
72 Ga0157370_10077451 3300013104 Bacteria 3132
73 Ga0157370_11063203 3300013104 Bacteria 732
74 Ga0157369_10000123 3300013105 Bacteria 110823
75 Ga0157378_10000027 3300013297 Bacteria 128412
76 Ga0157378_10428755 3300013297 Unclassified 1308
77 Ga0157378_11474805 3300013297 Unclassified 724
78 Ga0157378_11882025 3300013297 Unclassified 647
79 Ga0163162_11048042 3300013306 Unclassified 923
80 Ga0163162_12138265 3300013306 Unclassified 642
81 Ga0163162_12489778 3300013306 Bacteria 595
82 Ga0157372_10005548 3300013307 Bacteria 13413
83 Ga0157372_13020410 3300013307 Unclassified 538
84 Ga0157375_10000768 3300013308 Bacteria 28121
85 Ga0157376_11614602 3300014969 Bacteria 683
86 Ga0157376_12652448 3300014969 Unclassified 541
87 Ga0182006_1166211 3300015261 Bacteria 741
88 Ga0163161_11089208 3300017792 Archaea 686
89 Ga0213873_10064020 3300021358 Bacteria 1001
90 Ga0213871_10008825 3300021441 Bacteria 2237
91 Ga0209565_1015257 3300025263 Bacteria 1737
92 Ga0209564_1046656 3300025295 Bacteria 1101
93 Ga0209256_1000054 3300025299 Bacteria 298431
94 Ga0207684_10009211 3300025910 Bacteria 8726
95 Ga0207684_10138000 3300025910 Bacteria 2095
96 Ga0207684_11312041 3300025910 Unclassified 596
97 Ga0207707_10004504 3300025912 Bacteria 12254
98 Ga0207660_10335677 3300025917 Bacteria 1209
99 Ga0207657_10932257 3300025919 Bacteria 668
100 Ga0207652_10763080 3300025921 Unclassified 860
101 Ga0207700_11981742 3300025928 Unclassified 509
102 Ga0207706_11095420 3300025933 Bacteria 666
103 Ga0207661_10000007 3300025944 Bacteria 471636
104 Ga0207661_10014249 3300025944 Bacteria 5822
105 Ga0207667_10380734 3300025949 Bacteria 1438
106 Ga0207658_10972852 3300025986 Bacteria 774
107 Ga0207639_10811881 3300026041 Bacteria 872
108 Ga0207641_10186732 3300026088 Bacteria 1902
109 Ga0207648_10034507 3300026089 Bacteria 4460
110 Ga0268266_10898168 3300028379 Unclassified 857
111 Ga0268265_10037052 3300028380 Bacteria 3576
112 Ga0268264_12387969 3300028381 Unclassified 535
113 Ga0265319_1063890 3300028563 Bacteria 1189
114 Ga0265318_10082314 3300028577 Bacteria 1188
115 Ga0265338_10247681 3300028800 Unclassified 1316
116 Ga0265320_10374079 3300031240 Unclassified 629
117 Ga0265316_10141586 3300031344 Bacteria 1806
118 Ga0265313_10155471 3300031595 Viruses 974
119 Ga0316579_10544419 3300031691 Unclassified 562
120 Ga0316576_10487421 3300031727 Unclassified 908
121 Ga0307405_12161382 3300031731 Unclassified 500
122 Ga0316577_10278940 3300031733 Bacteria 946
123 Ga0307410_11413265 3300031852 Unclassified 611
124 Ga0307406_10146653 3300031901 Bacteria 1678
125 Ga0307407_10292362 3300031903 Bacteria 1133
126 Ga0307409_100153971 3300031995 Bacteria 2000
127 Ga0307416_100824887 3300032002 Bacteria 1024
128 Ga0307411_10592171 3300032005 Bacteria 952
129 Ga0316593_10143932 3300032168 Bacteria 864
130 Ga0316588_1119676 3300033528 Bacteria 666
131 Ga0316596_1072975 3300033541 Bacteria 920
132 Ga0373943_0041524 3300035170 Bacteria 2225
133 Ga0316574_0016206 3300035398 Unclassified 4339
134 Ga0373935_0363598 3300035692 Bacteria 1034
135 Ga0373927_0961138 3300035695 Unclassified 564
136 Ga0316582_0879019 3300036647 Unclassified 613
137 Ga0316584_0178011 3300036712 Bacteria 1575
138 Ga0373925_1191364 3300037068 Unclassified 626
139 Ga0395901_0751918 3300038443 Bacteria 968
140 Ga0400487_41013 3300039110 Bacteria 10661
141 Ga0436365_1716885 3300039437 Bacteria 1372
142 Ga0436360_0216515 3300039438 Bacteria 6846
143 Ga0436360_0654831 3300039438 Bacteria 3580
144 Ga0436362_1007329 3300039453 Bacteria 3219
145 Ga0451853_0254448 3300041512 Bacteria 559
146 Ga0439432_089248 3300042006 Bacteria 929
147 Ga0451577_0067836 3300042876 Bacteria 3182
148 Ga0453684_0349501 3300044712 Bacteria 1668
149 Ga0453684_0545480 3300044712 Bacteria 1278
150 Ga0451576_0083006 3300045051 Bacteria 3333
151 Ga0451576_0358577 3300045051 Bacteria 1527
152 Ga0451576_0916912 3300045051 Bacteria 919
153 Ga0495592_0211040 3300046454 Bacteria 1304
154 Ga0495629_0021106 3300046459 Bacteria 4648
155 Ga0495653_0063920 3300046463 Bacteria 2774
156 Ga0495650_0002469 3300046471 Bacteria 14877
157 Ga0495580_0001422 3300046472 Bacteria 21042
158 Ga0495580_0039156 3300046472 Bacteria 3391
159 Ga0495582_0206029 3300046473 Bacteria 1124
160 Ga0495584_0027293 3300046491 Bacteria 2893
161 Ga0495584_0064036 3300046491 Bacteria 1848
162 Ga0495584_0367746 3300046491 Bacteria 730
163 Ga0495585_0159952 3300046492 Bacteria 1169
164 Ga0495596_0109282 3300046500 Bacteria 1073
165 Ga0495632_0050232 3300046519 Bacteria 2058
166 Ga0495666_0012513 3300046526 Bacteria 4229
167 Ga0495652_0053568 3300046529 Bacteria 3438
168 Ga0495665_0046505 3300046531 Bacteria 2303
169 Ga0495586_0032384 3300046535 Bacteria 2802
170 Ga0495587_0017509 3300046536 Bacteria 4452
171 Ga0495609_0031225 3300046538 Bacteria 2423
172 Ga0495622_0033444 3300046557 Bacteria 2399
173 Ga0495667_0073608 3300046559 Bacteria 2225
174 Ga0495656_0035674 3300046615 Unclassified 2044
175 Ga0495634_0092248 3300046642 Bacteria 1965
176 Ga0495611_0428494 3300046648 Bacteria 603
177 Ga0495659_0020113 3300046664 Bacteria 2239
178 Ga0495588_0025178 3300046674 Bacteria 2962
179 Ga0495623_0033633 3300046679 Bacteria 3289
180 Ga0495646_0111728 3300046680 Bacteria 1555
181 Ga0495613_0095329 3300046689 Bacteria 2152
182 Ga0495624_0035361 3300046690 Bacteria 3225
183 Ga0495600_0010581 3300046809 Bacteria 5729
184 Ga0495581_0021967 3300047315 Bacteria 3698
185 Ga0495604_0039637 3300047317 Bacteria 3701
186 Ga0495636_0105759 3300047318 Bacteria 1234
187 Ga0495636_0133043 3300047318 Bacteria 1107
188 Ga0495674_0351117 3300047319 Bacteria 1197
189 Ga0495680_0343716 3300047322 Bacteria 1040
190 Ga0495675_0026177 3300047444 Bacteria 3718
191 Ga0495677_0198298 3300047445 Bacteria 780
192 Ga0495673_0024495 3300047469 Bacteria 2915
193 Ga0495593_0030072 3300047673 Bacteria 2974
194 Ga0495602_0025011 3300048088 Bacteria 5785
195 Ga0496103_0002299 3300048906 Bacteria 12076
196 Ga0496106_0167311 3300048909 Unclassified 1741
197 Ga0501038_0900349 3300049574 Unclassified 653
198 Ga0501040_0265834 3300049576 Bacteria 1224
199 Ga0501040_1060691 3300049576 Bacteria 588
200 Ga0501041_0065537 3300049577 Bacteria 2225
201 Ga0501041_0135294 3300049577 Bacteria 1536
202 Ga0501073_1250822 3300049589 Unclassified 509
203 Ga0501075_0928714 3300049591 Unclassified 661
204 Ga0501076_0533983 3300049592 Bacteria 967
205 Ga0501076_0759526 3300049592 Bacteria 800
206 Ga0501079_0106954 3300049741 Unclassified 2171
207 Ga0501045_1360185 3300049824 Bacteria 516
208 nmdc:mga0qj67_383716_c1 3300050509 Bacteria 1134
209 nmdc:mga06r32_983276_c1 3300050510 Unclassified 797
210 nmdc:mga0n895_452097_c1 3300050512 Unclassified 1297
211 nmdc:mga0rr50_79503_c1 3300050513 Bacteria 2525
212 nmdc:mga08x19_120_c1 3300050514 Bacteria 70057
213 nmdc:mga0a205_324900_c1 3300050515 Unclassified 1409
214 nmdc:mga0a205_656_c1 3300050515 Bacteria 27554
215 Ga0495655_0013309 3300053083 Bacteria 1699
216 Ga0501084_0901848 3300054114 Unclassified 743
217 Ga0501082_0357247 3300060353 Bacteria 1274
218 Ga0501082_0492578 3300060353 Bacteria 1071
219 Ga0501082_1029425 3300060353 Unclassified 720
220 2904428905 2904424332 Bacteria 7633521
221 Ga0070676_10407046
222 Ga0055526_1057519
223 Ga0055524_1000717
224 Ga0070683_100000009
225 Ga0070683_102315596
226 Ga0070670_101260311
227 Ga0068869_101769547
228 Ga0070666_11242914
229 Ga0070680_100253628
230 Ga0070680_100638071
231 Ga0070682_100337035
232 Ga0068868_100921484
233 Ga0070660_101480697
234 Ga0070692_10638176
235 Ga0070668_100376805
236 Ga0070669_101557031
237 Ga0070688_100183934
238 Ga0070688_101133264
239 Ga0070659_100047204
240 Ga0070694_100739242
241 Ga0070662_101213350
242 Ga0070681_10152908
243 Ga0070681_10744970
244 Ga0068867_100630651
245 Ga0070706_100007471
246 Ga0070706_100076674
247 Ga0070706_100184531
248 Ga0070706_101106792
249 Ga0070698_100025157
250 Ga0070699_100233299
251 Ga0070699_100433447
252 Ga0070699_101681922
253 Ga0070684_100000514
254 Ga0070684_100036413
255 Ga0068853_101075007
256 Ga0070686_101438901
257 Ga0070696_100030790
258 Ga0070693_100491056
259 Ga0070693_101356871
260 Ga0070665_101322933
261 Ga0070704_101707460
262 Ga0068855_100508155
263 Ga0068855_102445959
264 Ga0068854_101455273
265 Ga0068859_101086338
266 Ga0068864_101846551
267 Ga0068851_10107916
268 Ga0068863_100296443
269 Ga0068860_100453492
270 Ga0068860_102522144
271 Ga0068862_100153024
272 Ga0068862_100394853
273 Ga0097621_100044200
274 Ga0097621_100648254
275 Ga0068871_100276160
276 Ga0068871_100846060
277 Ga0068871_102280627
278 Ga0075428_100280206
279 Ga0075430_100318712
280 Ga0075433_10107249
281 Ga0075434_100358051
282 Ga0075436_100951684
283 Ga0097620_101086340
284 Ga0075435_100869065
285 Ga0099794_10594653
286 Ga0105240_10145245
287 Ga0114129_13236262
288 Ga0105242_10915916
289 Ga0105239_11845436
290 Ga0105246_10529858
291 Ga0157373_11017573
292 Ga0157370_10077451
293 Ga0157370_11063203
294 Ga0157369_10000123
295 Ga0157378_10000027
296 Ga0157378_10428755
297 Ga0157378_11474805
298 Ga0157378_11882025
299 Ga0163162_11048042
300 Ga0163162_12138265
301 Ga0163162_12489778
302 Ga0157372_10005548
303 Ga0157372_13020410
304 Ga0157375_10000768
305 Ga0157376_11614602
306 Ga0157376_12652448
307 Ga0182006_1166211
308 Ga0163161_11089208
309 Ga0213873_10064020
310 Ga0213871_10008825
311 Ga0209565_1015257
312 Ga0209564_1046656
313 Ga0209256_1000054
314 Ga0207684_10009211
315 Ga0207684_10138000
316 Ga0207684_11312041
317 Ga0207707_10004504
318 Ga0207660_10335677
319 Ga0207657_10932257
320 Ga0207652_10763080
321 Ga0207700_11981742
322 Ga0207706_11095420
323 Ga0207661_10000007
324 Ga0207661_10014249
325 Ga0207667_10380734
326 Ga0207658_10972852
327 Ga0207639_10811881
328 Ga0207641_10186732
329 Ga0207648_10034507
330 Ga0268266_10898168
331 Ga0268265_10037052
332 Ga0268264_12387969
333 Ga0265319_1063890
334 Ga0265318_10082314
335 Ga0265338_10247681
336 Ga0265320_10374079
337 Ga0265316_10141586
338 Ga0265313_10155471
339 Ga0316579_10544419
340 Ga0316576_10487421
341 Ga0307405_12161382
342 Ga0316577_10278940
343 Ga0307410_11413265
344 Ga0307406_10146653
345 Ga0307407_10292362
346 Ga0307409_100153971
347 Ga0307416_100824887
348 Ga0307411_10592171
349 Ga0316593_10143932
350 Ga0316588_1119676
351 Ga0316596_1072975
352 Ga0373943_0041524
353 Ga0316574_0016206
354 Ga0373935_0363598
355 Ga0373927_0961138
356 Ga0316582_0879019
357 Ga0316584_0178011
358 Ga0373925_1191364
359 Ga0395901_0751918
360 Ga0400487_41013
361 Ga0436365_1716885
362 Ga0436360_0216515
363 Ga0436360_0654831
364 Ga0436362_1007329
365 Ga0451853_0254448
366 Ga0439432_089248
367 Ga0451577_0067836
368 Ga0453684_0349501
369 Ga0453684_0545480
370 Ga0451576_0083006
371 Ga0451576_0358577
372 Ga0451576_0916912
373 Ga0495592_0211040
374 Ga0495629_0021106
375 Ga0495653_0063920
376 Ga0495650_0002469
377 Ga0495580_0001422
378 Ga0495580_0039156
379 Ga0495582_0206029
380 Ga0495584_0027293
381 Ga0495584_0064036
382 Ga0495584_0367746
383 Ga0495585_0159952
384 Ga0495596_0109282
385 Ga0495632_0050232
386 Ga0495666_0012513
387 Ga0495652_0053568
388 Ga0495665_0046505
389 Ga0495586_0032384
390 Ga0495587_0017509
391 Ga0495609_0031225
392 Ga0495622_0033444
393 Ga0495667_0073608
394 Ga0495656_0035674
395 Ga0495634_0092248
396 Ga0495611_0428494
397 Ga0495659_0020113
398 Ga0495588_0025178
399 Ga0495623_0033633
400 Ga0495646_0111728
401 Ga0495613_0095329
402 Ga0495624_0035361
403 Ga0495600_0010581
404 Ga0495581_0021967
405 Ga0495604_0039637
406 Ga0495636_0105759
407 Ga0495636_0133043
408 Ga0495674_0351117
409 Ga0495680_0343716
410 Ga0495675_0026177
411 Ga0495677_0198298
412 Ga0495673_0024495
413 Ga0495593_0030072
414 Ga0495602_0025011
415 Ga0496103_0002299
416 Ga0496106_0167311
417 Ga0501038_0900349
418 Ga0501040_0265834
419 Ga0501040_1060691
420 Ga0501041_0065537
421 Ga0501041_0135294
422 Ga0501073_1250822
423 Ga0501075_0928714
424 Ga0501076_0533983
425 Ga0501076_0759526
426 Ga0501079_0106954
427 Ga0501045_1360185
428 nmdc:mga0qj67_383716_c1
429 nmdc:mga06r32_983276_c1
430 nmdc:mga0n895_452097_c1
431 nmdc:mga0rr50_79503_c1
432 nmdc:mga08x19_120_c1
433 nmdc:mga0a205_324900_c1
434 nmdc:mga0a205_656_c1
435 Ga0495655_0013309
436 Ga0501084_0901848
437 Ga0501082_0357247
438 Ga0501082_0492578
439 Ga0501082_1029425
440 2904428905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

11

63

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g7j-assembly1.cif.gz_A solution nmr structure of the putative cytoplasmic protein ygac from salmonella typhimurium. northeast structural genomics target str72. 0.8969 6 43
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.8952 4 68
5yrz-assembly1.cif.gz_D toxin-antitoxin complex from streptococcus pneumoniae 0.8934 7 61
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8838 7 61
5yrz-assembly1.cif.gz_D toxin-antitoxin complex from streptococcus pneumoniae 0.837 7 61
ID Description Score Start End Superfamily
4fbiC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9351 47 69 1.10.260.40
1whzA00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9003 6 68 3.30.920.30
2g7jA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Protein of unknown function DUF2002 0.8969 6 43 3.90.1150.40
5yrzD00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8934 7 61 3.30.920.30
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8838 7 61 3.30.920.30
ID Description Score Start End GO Terms
AF-A0A552QC21-F1-model_v4 Addiction module toxin, HicA family 0.9892 3 69 GO:0003729
GO:0004519
AF-A0A7Z9JZG1-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9829 1 70 GO:0003729
GO:0004519
AF-A0A354F7J6-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.981 1 70 GO:0003729
GO:0004519
AF-A4BRJ0-F1-model_v4 YcfA-like protein 0.9802 14 70
AF-A0A6L7TUK9-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9746 1 70

Map