F331645

General Info

Members Datasets Scaffolds Average Seq Length
219 134 438 229

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221576|2643892735
Length 259
Sequence MPDDVRARMVDHVPDEIPEDLPDWLRPLAEGARSIEGIELTQFLPPAGGNPRRGAVLMLFGEGDAGGDVLLTERAHHMRSHPGQVSFPGGTIDPGETAVEAALRETWEEIGVDPGSVEIFGALPELWLPPSNFAVTPILGWWRDPGPVRVASPDEVHEIHRVGLRELVDPEHRISVRHPGGWNGPGFLIGDDKDVILWGFTGGILTRFFSFLGWLPPVEDPPVHDLPEYMLAEYVRRTSATGDDDRTGDDGMDLLEPDE

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
8 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
9 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
10 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
39 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
42 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
53 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
54 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
55 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
56 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
57 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
58 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
73 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
79 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
80 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
113 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
114 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
115 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
120 2643221576 Nocardioides sp. Root614 Isolate Unclassified
121 2643221561 Nocardioides sp. Root151 Isolate Unclassified
122 2643221590 Nocardioides sp. Root682 Isolate Unclassified
123 2643221604 Nocardioides sp. Root190 Isolate Unclassified
124 2643221615 Nocardioides sp. Root224 Isolate Unclassified
125 2643221617 Nocardioides sp. Root79 Isolate Unclassified
126 2643221620 Nocardioides sp. Root240 Isolate Unclassified
127 2643221641 Nocardioides sp. Root122 Isolate Unclassified
128 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
129 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
130 2643221696 Nocardioides sp. Root140 Isolate Unclassified
131 2739367898 Nocardioides sp. CF479 Isolate Unclassified
132 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
133 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
134 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.69
Metatranscriptomes 0.46
Isolates 6.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.76
Nodule 0.46
Rhizoplane 4.11
Rhizosphere 77.17
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002530 3300000549 Bacteria 2534
2 Ga0006562J51391_1072817 3300003578 Bacteria 1680
3 Ga0070680_100388866 3300005336 Bacteria 1188
4 Ga0070675_100672326 3300005354 Bacteria 942
5 Ga0070667_100260690 3300005367 Bacteria 1552
6 Ga0070700_100032490 3300005441 Bacteria 3136
7 Ga0068864_100542676 3300005618 Bacteria 1123
8 Ga0068866_10309752 3300005718 Bacteria 989
9 Ga0068861_100146015 3300005719 Bacteria 1936
10 Ga0068861_100404231 3300005719 Bacteria 1213
11 Ga0068870_10287048 3300005840 Bacteria 1034
12 Ga0081539_10061004 3300005985 Bacteria 2068
13 Ga0075365_10008933 3300006038 Bacteria 5725
14 Ga0075365_10061900 3300006038 Bacteria 2501
15 Ga0075365_10076107 3300006038 Bacteria 2266
16 Ga0075365_10083642 3300006038 Bacteria 2165
17 Ga0075368_10127596 3300006042 Bacteria 1056
18 Ga0075363_100158062 3300006048 Bacteria 1282
19 Ga0075364_10178302 3300006051 Bacteria 1437
20 Ga0075370_10209689 3300006353 Bacteria 1150
21 Ga0105247_10356859 3300009101 Bacteria 1030
22 Ga0105242_10601455 3300009176 Bacteria 1062
23 Ga0105248_11198295 3300009177 Bacteria 859
24 Ga0105249_10583954 3300009553 Bacteria 1171
25 Ga0157370_11266774 3300013104 Bacteria 665
26 Ga0157372_11033161 3300013307 Bacteria 951
27 Ga0157375_10179712 3300013308 Bacteria 2267
28 Ga0163163_10093901 3300014325 Bacteria 3017
29 Ga0157380_10105935 3300014326 Bacteria 2352
30 Ga0157380_10182222 3300014326 Bacteria 1846
31 Ga0163161_10684589 3300017792 Bacteria 852
32 Ga0213875_10016521 3300021388 Bacteria 3577
33 Ga0207688_10070165 3300025901 Bacteria 1987
34 Ga0207688_10253749 3300025901 Bacteria 1066
35 Ga0207643_10170696 3300025908 Bacteria 1313
36 Ga0207705_10207668 3300025909 Bacteria 1485
37 Ga0207659_10336249 3300025926 Bacteria 1250
38 Ga0207709_10056172 3300025935 Bacteria 2435
39 Ga0207691_10212000 3300025940 Bacteria 1682
40 Ga0207668_10142563 3300025972 Bacteria 1845
41 Ga0207708_10035734 3300026075 Bacteria 3781
42 Ga0207641_10813810 3300026088 Bacteria 925
43 Ga0207675_100091093 3300026118 Bacteria 2867
44 Ga0307405_10147820 3300031731 Bacteria 1648
45 Ga0307405_10330769 3300031731 Bacteria 1168
46 Ga0307413_10019835 3300031824 Bacteria 3562
47 Ga0307410_10088121 3300031852 Bacteria 2197
48 Ga0307406_10091819 3300031901 Bacteria 2046
49 Ga0307407_10004960 3300031903 Bacteria 5723
50 Ga0307407_10017474 3300031903 Bacteria 3600
51 Ga0307412_10428947 3300031911 Bacteria 1083
52 Ga0307409_100002887 3300031995 Bacteria 9108
53 Ga0307409_100003456 3300031995 Bacteria 8578
54 Ga0307409_100162763 3300031995 Bacteria 1954
55 Ga0307409_100217909 3300031995 Bacteria 1721
56 Ga0307409_100330666 3300031995 Bacteria 1430
57 Ga0307416_100003722 3300032002 Bacteria 9043
58 Ga0307416_100013696 3300032002 Bacteria 5522
59 Ga0307416_100156135 3300032002 Bacteria 2101
60 Ga0307416_100593486 3300032002 Bacteria 1186
61 Ga0307414_10298384 3300032004 Bacteria 1362
62 Ga0307414_10456657 3300032004 Bacteria 1122
63 Ga0307411_10056463 3300032005 Bacteria 2588
64 Ga0307415_100021021 3300032126 Bacteria 4000
65 Ga0307415_100170057 3300032126 Bacteria 1698
66 Ga0307415_100545436 3300032126 Bacteria 1022
67 Ga0395900_0546722 3300037418 Bacteria 1103
68 Ga0395898_0127503 3300037466 Bacteria 2438
69 Ga0436364_0916678 3300037853 Bacteria 3817
70 Ga0439465_0229900 3300041413 Bacteria 682
71 Ga0451791_1398273 3300041451 Bacteria 1079
72 Ga0451791_1484777 3300041451 Bacteria 1062
73 Ga0451806_189097 3300041462 Bacteria 756
74 Ga0451837_0014698 3300041494 Bacteria 1136
75 Ga0451837_1242684 3300041494 Bacteria 1624
76 Ga0451843_1710175 3300041509 Bacteria 938
77 Ga0451853_3546826 3300041512 Bacteria 2132
78 Ga0439431_0077524 3300041997 Bacteria 893
79 Ga0466969_0080836 3300044656 Bacteria 1552
80 Ga0466972_0138392 3300044658 Bacteria 1146
81 Ga0466965_0004714 3300044683 Bacteria 6081
82 Ga0466965_0008563 3300044683 Bacteria 4734
83 Ga0466965_0009846 3300044683 Bacteria 4444
84 Ga0466966_0068416 3300044684 Bacteria 2229
85 Ga0466961_0031749 3300044693 Bacteria 3396
86 Ga0466961_0068391 3300044693 Bacteria 2255
87 Ga0466963_0027647 3300044694 Bacteria 3634
88 Ga0466963_0039781 3300044694 Bacteria 3081
89 Ga0466963_0482534 3300044694 Bacteria 875
90 Ga0466964_0008539 3300044706 Bacteria 3850
91 Ga0466964_0141277 3300044706 Bacteria 1107
92 Ga0466971_0024395 3300044719 Bacteria 2698
93 Ga0466971_0139360 3300044719 Bacteria 1129
94 Ga0466970_0019577 3300044765 Bacteria 3510
95 Ga0466970_0057626 3300044765 Bacteria 2077
96 Ga0466970_0063394 3300044765 Bacteria 1981
97 Ga0466957_0008804 3300044842 Bacteria 5746
98 Ga0466957_0038302 3300044842 Bacteria 2888
99 Ga0466957_0077401 3300044842 Bacteria 2066
100 Ga0466960_0003046 3300044901 Bacteria 6405
101 Ga0466960_0005326 3300044901 Bacteria 5088
102 Ga0466960_0021786 3300044901 Bacteria 2857
103 Ga0466960_0036855 3300044901 Bacteria 2292
104 Ga0466960_0144635 3300044901 Bacteria 1265
105 Ga0466959_0158564 3300045049 Bacteria 1591
106 Ga0466959_0204962 3300045049 Bacteria 1372
107 Ga0466967_0016035 3300045976 Bacteria 5894
108 Ga0466967_0027485 3300045976 Bacteria 4733
109 Ga0466967_0106267 3300045976 Bacteria 2573
110 Ga0466967_0118215 3300045976 Bacteria 2445
111 Ga0466967_0155045 3300045976 Bacteria 2144
112 Ga0466967_0555040 3300045976 Bacteria 1131
113 Ga0495657_0025912 3300046675 Bacteria 4160
114 Ga0495593_0270543 3300047673 Bacteria 850
115 Ga0496102_0487881 3300048905 Bacteria 1154
116 Ga0496102_0986433 3300048905 Bacteria 763
117 Ga0496106_0063274 3300048909 Bacteria 2812
118 Ga0496109_0253084 3300048912 Bacteria 1659
119 Ga0496110_0083143 3300048913 Bacteria 2856
120 Ga0496114_0134068 3300048917 Bacteria 2141
121 Ga0496123_0021969 3300048926 Bacteria 4936
122 Ga0496126_0192857 3300048929 Bacteria 1725
123 Ga0501031_0007645 3300049568 Bacteria 7034
124 Ga0501032_0067004 3300049569 Bacteria 2399
125 Ga0501032_0200933 3300049569 Bacteria 1301
126 Ga0501032_0226672 3300049569 Unclassified 1215
127 Ga0501032_0560471 3300049569 Bacteria 728
128 Ga0501033_0092860 3300049570 Bacteria 2207
129 Ga0501034_0101889 3300049571 Bacteria 2865
130 Ga0501036_0002618 3300049572 Bacteria 14186
131 Ga0501036_0086629 3300049572 Bacteria 2647
132 Ga0501036_0492117 3300049572 Bacteria 1021
133 Ga0501036_0893438 3300049572 Bacteria 729
134 Ga0501037_0019812 3300049573 Bacteria 4964
135 Ga0501038_0016954 3300049574 Bacteria 6590
136 Ga0501038_0494284 3300049574 Bacteria 936
137 Ga0501039_0013256 3300049575 Bacteria 6303
138 Ga0501039_0016774 3300049575 Bacteria 5613
139 Ga0501039_0044797 3300049575 Bacteria 3418
140 Ga0501039_0049215 3300049575 Bacteria 3258
141 Ga0501039_0072364 3300049575 Bacteria 2678
142 Ga0501040_0004060 3300049576 Bacteria 9516
143 Ga0501040_0019600 3300049576 Bacteria 4501
144 Ga0501040_0310596 3300049576 Bacteria 1127
145 Ga0501040_0334073 3300049576 Bacteria 1085
146 Ga0501041_0015297 3300049577 Bacteria 4556
147 Ga0501042_0057388 3300049578 Bacteria 2778
148 Ga0501042_0469141 3300049578 Bacteria 913
149 Ga0501042_0476065 3300049578 Bacteria 906
150 Ga0501043_0129337 3300049579 Bacteria 1979
151 Ga0501046_0026128 3300049580 Bacteria 4770
152 Ga0501048_0010713 3300049582 Bacteria 6838
153 Ga0501048_0108213 3300049582 Bacteria 1962
154 Ga0501067_0029707 3300049583 Bacteria 3029
155 Ga0501067_0061782 3300049583 Bacteria 2074
156 Ga0501067_0105644 3300049583 Bacteria 1565
157 Ga0501068_0004967 3300049584 Bacteria 7247
158 Ga0501068_0245245 3300049584 Bacteria 1141
159 Ga0501068_0405733 3300049584 Bacteria 879
160 Ga0501069_0015841 3300049585 Bacteria 4041
161 Ga0501069_0057855 3300049585 Bacteria 2162
162 Ga0501070_0230521 3300049586 Bacteria 1517
163 Ga0501070_0317169 3300049586 Bacteria 1268
164 Ga0501070_0712295 3300049586 Bacteria 793
165 Ga0501071_0002665 3300049587 Bacteria 10931
166 Ga0501071_0008265 3300049587 Bacteria 6871
167 Ga0501071_0041186 3300049587 Bacteria 3308
168 Ga0501072_0009323 3300049588 Bacteria 7459
169 Ga0501072_0013130 3300049588 Bacteria 6340
170 Ga0501072_0044833 3300049588 Bacteria 3477
171 Ga0501072_0552714 3300049588 Bacteria 909
172 Ga0501073_0062972 3300049589 Bacteria 2587
173 Ga0501074_0028128 3300049590 Bacteria 4074
174 Ga0501075_0051218 3300049591 Bacteria 3104
175 Ga0501076_0011994 3300049592 Bacteria 6474
176 Ga0501076_0021589 3300049592 Bacteria 4940
177 Ga0501079_0024113 3300049741 Bacteria 4668
178 Ga0501079_0032526 3300049741 Bacteria 4010
179 Ga0501081_0007082 3300049743 Bacteria 7290
180 Ga0501081_0137834 3300049743 Bacteria 1747
181 Ga0501035_0022020 3300049822 Bacteria 5855
182 Ga0501035_0036663 3300049822 Bacteria 4443
183 Ga0501044_0442519 3300049823 Bacteria 1207
184 Ga0501045_0009526 3300049824 Bacteria 6795
185 Ga0501045_0014700 3300049824 Bacteria 5550
186 Ga0501045_0040016 3300049824 Bacteria 3411
187 nmdc:mga0yw44_129626_c1 3300050492 Bacteria 1631
188 nmdc:mga0yw44_1647_c1 3300050492 Bacteria 5017
189 nmdc:mga0yw44_168688_c1 3300050492 Bacteria 1436
190 nmdc:mga0yw44_2712_c1 3300050492 Bacteria 7648
191 nmdc:mga0yw44_32243_c1 3300050492 Bacteria 3052
192 nmdc:mga06z11_198624_c1 3300050494 Bacteria 1164
193 Ga0495619_0014986 3300053085 Bacteria 4898
194 Ga0500556_0000483 3300053104 Bacteria 27786
195 Ga0500593_006236 3300053117 Bacteria 4759
196 Ga0500573_0013416 3300053140 Bacteria 4618
197 Ga0501084_0013432 3300054114 Bacteria 6776
198 Ga0501084_0022556 3300054114 Bacteria 5254
199 Ga0501082_0122460 3300060353 Bacteria 2255
200 Ga0466962_0009416 3300061719 Bacteria 4682
201 Ga0466962_0034968 3300061719 Bacteria 2406
202 Ga0530510_0010160 3300061734 Bacteria 6598
203 Ga0530510_0130950 3300061734 Bacteria 1845
204 Ga0530510_0419604 3300061734 Bacteria 1010
205 2643892735 2643221576 Bacteria 5214352
206 2643824861 2643221561 Bacteria 4984412
207 2643962184 2643221590 Bacteria 5214697
208 2644032161 2643221604 Bacteria 5014917
209 2644093302 2643221615 Bacteria 5487866
210 2644100070 2643221617 Bacteria 5139111
211 2644117676 2643221620 Bacteria 5134593
212 2644232098 2643221641 Bacteria 4490190
213 2644322912 2643221657 Bacteria 5490246
214 2644454920 2643221681 Bacteria 3707866
215 2644532588 2643221696 Bacteria 5431823
216 2740168537 2739367898 Bacteria 4367674
217 2812334965 2811994874 Bacteria 5367947
218 2855390118 2855386786 Bacteria 4752232
219 8054614040 8054609563 Bacteria 5170090
220 LJQas_1002530
221 Ga0006562J51391_1072817
222 Ga0070680_100388866
223 Ga0070675_100672326
224 Ga0070667_100260690
225 Ga0070700_100032490
226 Ga0068864_100542676
227 Ga0068866_10309752
228 Ga0068861_100146015
229 Ga0068861_100404231
230 Ga0068870_10287048
231 Ga0081539_10061004
232 Ga0075365_10008933
233 Ga0075365_10061900
234 Ga0075365_10076107
235 Ga0075365_10083642
236 Ga0075368_10127596
237 Ga0075363_100158062
238 Ga0075364_10178302
239 Ga0075370_10209689
240 Ga0105247_10356859
241 Ga0105242_10601455
242 Ga0105248_11198295
243 Ga0105249_10583954
244 Ga0157370_11266774
245 Ga0157372_11033161
246 Ga0157375_10179712
247 Ga0163163_10093901
248 Ga0157380_10105935
249 Ga0157380_10182222
250 Ga0163161_10684589
251 Ga0213875_10016521
252 Ga0207688_10070165
253 Ga0207688_10253749
254 Ga0207643_10170696
255 Ga0207705_10207668
256 Ga0207659_10336249
257 Ga0207709_10056172
258 Ga0207691_10212000
259 Ga0207668_10142563
260 Ga0207708_10035734
261 Ga0207641_10813810
262 Ga0207675_100091093
263 Ga0307405_10147820
264 Ga0307405_10330769
265 Ga0307413_10019835
266 Ga0307410_10088121
267 Ga0307406_10091819
268 Ga0307407_10004960
269 Ga0307407_10017474
270 Ga0307412_10428947
271 Ga0307409_100002887
272 Ga0307409_100003456
273 Ga0307409_100162763
274 Ga0307409_100217909
275 Ga0307409_100330666
276 Ga0307416_100003722
277 Ga0307416_100013696
278 Ga0307416_100156135
279 Ga0307416_100593486
280 Ga0307414_10298384
281 Ga0307414_10456657
282 Ga0307411_10056463
283 Ga0307415_100021021
284 Ga0307415_100170057
285 Ga0307415_100545436
286 Ga0395900_0546722
287 Ga0395898_0127503
288 Ga0436364_0916678
289 Ga0439465_0229900
290 Ga0451791_1398273
291 Ga0451791_1484777
292 Ga0451806_189097
293 Ga0451837_0014698
294 Ga0451837_1242684
295 Ga0451843_1710175
296 Ga0451853_3546826
297 Ga0439431_0077524
298 Ga0466969_0080836
299 Ga0466972_0138392
300 Ga0466965_0004714
301 Ga0466965_0008563
302 Ga0466965_0009846
303 Ga0466966_0068416
304 Ga0466961_0031749
305 Ga0466961_0068391
306 Ga0466963_0027647
307 Ga0466963_0039781
308 Ga0466963_0482534
309 Ga0466964_0008539
310 Ga0466964_0141277
311 Ga0466971_0024395
312 Ga0466971_0139360
313 Ga0466970_0019577
314 Ga0466970_0057626
315 Ga0466970_0063394
316 Ga0466957_0008804
317 Ga0466957_0038302
318 Ga0466957_0077401
319 Ga0466960_0003046
320 Ga0466960_0005326
321 Ga0466960_0021786
322 Ga0466960_0036855
323 Ga0466960_0144635
324 Ga0466959_0158564
325 Ga0466959_0204962
326 Ga0466967_0016035
327 Ga0466967_0027485
328 Ga0466967_0106267
329 Ga0466967_0118215
330 Ga0466967_0155045
331 Ga0466967_0555040
332 Ga0495657_0025912
333 Ga0495593_0270543
334 Ga0496102_0487881
335 Ga0496102_0986433
336 Ga0496106_0063274
337 Ga0496109_0253084
338 Ga0496110_0083143
339 Ga0496114_0134068
340 Ga0496123_0021969
341 Ga0496126_0192857
342 Ga0501031_0007645
343 Ga0501032_0067004
344 Ga0501032_0200933
345 Ga0501032_0226672
346 Ga0501032_0560471
347 Ga0501033_0092860
348 Ga0501034_0101889
349 Ga0501036_0002618
350 Ga0501036_0086629
351 Ga0501036_0492117
352 Ga0501036_0893438
353 Ga0501037_0019812
354 Ga0501038_0016954
355 Ga0501038_0494284
356 Ga0501039_0013256
357 Ga0501039_0016774
358 Ga0501039_0044797
359 Ga0501039_0049215
360 Ga0501039_0072364
361 Ga0501040_0004060
362 Ga0501040_0019600
363 Ga0501040_0310596
364 Ga0501040_0334073
365 Ga0501041_0015297
366 Ga0501042_0057388
367 Ga0501042_0469141
368 Ga0501042_0476065
369 Ga0501043_0129337
370 Ga0501046_0026128
371 Ga0501048_0010713
372 Ga0501048_0108213
373 Ga0501067_0029707
374 Ga0501067_0061782
375 Ga0501067_0105644
376 Ga0501068_0004967
377 Ga0501068_0245245
378 Ga0501068_0405733
379 Ga0501069_0015841
380 Ga0501069_0057855
381 Ga0501070_0230521
382 Ga0501070_0317169
383 Ga0501070_0712295
384 Ga0501071_0002665
385 Ga0501071_0008265
386 Ga0501071_0041186
387 Ga0501072_0009323
388 Ga0501072_0013130
389 Ga0501072_0044833
390 Ga0501072_0552714
391 Ga0501073_0062972
392 Ga0501074_0028128
393 Ga0501075_0051218
394 Ga0501076_0011994
395 Ga0501076_0021589
396 Ga0501079_0024113
397 Ga0501079_0032526
398 Ga0501081_0007082
399 Ga0501081_0137834
400 Ga0501035_0022020
401 Ga0501035_0036663
402 Ga0501044_0442519
403 Ga0501045_0009526
404 Ga0501045_0014700
405 Ga0501045_0040016
406 nmdc:mga0yw44_129626_c1
407 nmdc:mga0yw44_1647_c1
408 nmdc:mga0yw44_168688_c1
409 nmdc:mga0yw44_2712_c1
410 nmdc:mga0yw44_32243_c1
411 nmdc:mga06z11_198624_c1
412 Ga0495619_0014986
413 Ga0500556_0000483
414 Ga0500593_006236
415 Ga0500573_0013416
416 Ga0501084_0013432
417 Ga0501084_0022556
418 Ga0501082_0122460
419 Ga0466962_0009416
420 Ga0466962_0034968
421 Ga0530510_0010160
422 Ga0530510_0130950
423 Ga0530510_0419604
424 2643892735
425 2643824861
426 2643962184
427 2644032161
428 2644093302
429 2644100070
430 2644117676
431 2644232098
432 2644322912
433 2644454920
434 2644532588
435 2740168537
436 2812334965
437 2855390118
438 8054614040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

50

179

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ypf-assembly1.cif.gz_A nudix1 hydrolase from rosa x hybrida in complex with geranyl pyrophosphate 0.8855 35 144
1ktg-assembly2.cif.gz_B crystal structure of a c. elegans ap4a hydrolase binary complex 0.8721 37 151
5cfi-assembly3.cif.gz_C structural and functional attributes of malaria parasite ap4a hydrolase 0.8239 36 144
4ijx-assembly3.cif.gz_B-2 crystal structure of human ap4a hydrolase e58a mutant complexed with dpo 0.821 36 144
1ktg-assembly1.cif.gz_A crystal structure of a c. elegans ap4a hydrolase binary complex 0.8191 35 151
ID Description Score Start End Superfamily
af_A4ICV7_70_295_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8805 27 193 3.90.79.10
af_O13717_28_182_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8781 35 153 3.90.79.10
af_Q9ZQZ4_1_85_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8741 156 168 3.10.20.90
af_A0A1D8PU14_38_158_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8615 38 138 3.90.79.10
af_B4FX37_49_233_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8509 24 148 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A4T0VBX1-F1-model_v4 CoA pyrophosphatase 0.9858 41 213 GO:0000287
GO:0009132
GO:0010945
GO:0030145
AF-A0A3N0GQF4-F1-model_v4 CoA pyrophosphatase 0.9787 4 214 GO:0000287
GO:0009132
GO:0010945
GO:0030145
AF-A0A852S284-F1-model_v4 8-oxo-dGTP pyrophosphatase MutT (NUDIX family) 0.9785 1 213 GO:0000287
GO:0009132
GO:0010945
GO:0030145
AF-A0A7J5DS25-F1-model_v4 CoA pyrophosphatase 0.9783 1 213 GO:0000287
GO:0009132
GO:0010945
GO:0030145
AF-A0A6G7XW38-F1-model_v4 CoA pyrophosphatase 0.9739 4 214 GO:0000287
GO:0009132
GO:0010945
GO:0030145

Map