F331603

General Info

Members Datasets Scaffolds Average Seq Length
219 141 438 607

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_90028_c1|nmdc:mga0a205_90028_c1_56_2077
Length 662
Sequence LSFHEEEVLGKAYDATLMRRLLQYLRPYKPQVALALAAIISASVLQLAQPYLMKLAIDRYIANRDLGGVDRIALAYFAILLGSFVLEYVQTWLLQMTGQRIMYDMRLQIYQHLQRIDLQFYDRNPVGRLMTRVTTDVDVINDMFTSGVVSIFGDVFTLAGIMIVLVTMDWRLALVTFAVLPLIVLVTQWFRRNVRESYRTVRAWVARINAFLQEHITGMSTVQLFRREGRTFERFDDINRRHRDANIDSILYYAVFYPAIEIIGALAAALIIWFGGRWTLQGTLTLGSLVAFLLYSSRFFRPISDMSEKFNVLQAAMASSERIFKLLDAPVRIQSRSAAGDSRLAMPAAPRVEEPSGTAEPRTASREPRQEGHIVFDRVWFAYDATVASTGPDPGSRPSTSSGRPEPVEGRIADPDVSASPSPKDPTFVLRDVSFEVKPGERVGVVGATGAGKSTLINLLLRFYDVTRGRILVDGMDVREMELSELRRLFGLVLQDVHLFSGTIAANIRLGDQSITDAAVRRAAEAVHANRFIDRLPSGYDSPVAERGATLSVGQKQLLSFARALAFNPRVLVLDEATSSIDTETELLIRDALEVLMAGRTTIAIAHRLSTIQDMDKILVLHKGQLREVGTHQELLAQRGIYYKLYQLQYRDAAETIAVPPD

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
96 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
97 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
98 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
101 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 0
Rhizoplane 7.31
Rhizosphere 86.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_90028_c1 3300050515 Bacteria 2256
2 Ga0065712_10001453 3300005290 Bacteria 6132
3 Ga0065712_10068034 3300005290 Bacteria 16477
4 Ga0065715_10007660 3300005293 Bacteria 2620
5 Ga0065715_10111732 3300005293 Bacteria 2561
6 Ga0065707_10092263 3300005295 Bacteria 3797
7 Ga0070683_100000193 3300005329 Bacteria 40749
8 Ga0070683_100096819 3300005329 Bacteria 2776
9 Ga0070690_100020536 3300005330 Bacteria 4024
10 Ga0070670_100011059 3300005331 Bacteria 7710
11 Ga0070670_100025222 3300005331 Bacteria 5116
12 Ga0070670_100075264 3300005331 Bacteria 2901
13 Ga0070687_100004242 3300005343 Bacteria 5694
14 Ga0070687_100005904 3300005343 Bacteria 4979
15 Ga0070661_100030865 3300005344 Bacteria 3873
16 Ga0070669_100002976 3300005353 Bacteria 12213
17 Ga0070669_100039705 3300005353 Bacteria 3420
18 Ga0070675_100016779 3300005354 Bacteria 5815
19 Ga0070671_100011259 3300005355 Bacteria 7186
20 Ga0070673_100001496 3300005364 Bacteria 13713
21 Ga0070673_100017448 3300005364 Bacteria 5106
22 Ga0070673_100076624 3300005364 Bacteria 2701
23 Ga0070688_100004458 3300005365 Bacteria 7290
24 Ga0070713_100004565 3300005436 Bacteria 9336
25 Ga0070681_10056112 3300005458 Bacteria 3920
26 Ga0068867_100104320 3300005459 Bacteria 2170
27 Ga0070685_10032730 3300005466 Bacteria 2914
28 Ga0070698_100094779 3300005471 Bacteria 2963
29 Ga0070679_100119879 3300005530 Bacteria 2616
30 Ga0070679_100166999 3300005530 Bacteria 2174
31 Ga0070684_100004130 3300005535 Bacteria 10989
32 Ga0070684_100066444 3300005535 Bacteria 3166
33 Ga0070686_100019043 3300005544 Bacteria 4039
34 Ga0070686_100027367 3300005544 Bacteria 3451
35 Ga0070665_100025234 3300005548 Bacteria 5988
36 Ga0068855_100002008 3300005563 Bacteria 25247
37 Ga0068855_100177176 3300005563 Bacteria 2412
38 Ga0070664_100002758 3300005564 Bacteria 14176
39 Ga0068857_100064381 3300005577 Bacteria 3260
40 Ga0068856_100062804 3300005614 Bacteria 3669
41 Ga0068859_100095776 3300005617 Bacteria 3021
42 Ga0068864_100007871 3300005618 Bacteria 8782
43 Ga0068858_100008481 3300005842 Bacteria 9878
44 Ga0081539_10032611 3300005985 Bacteria 3187
45 Ga0075368_10029280 3300006042 Bacteria 2129
46 Ga0075364_10023038 3300006051 Bacteria 3939
47 Ga0075362_10000517 3300006177 Bacteria 11262
48 Ga0075367_10014228 3300006178 Bacteria 4302
49 Ga0075366_10004151 3300006195 Bacteria 7759
50 Ga0075366_10024750 3300006195 Bacteria 3502
51 Ga0097621_100001248 3300006237 Bacteria 17586
52 Ga0097621_100019238 3300006237 Bacteria 5238
53 Ga0075370_10019353 3300006353 Bacteria 3707
54 Ga0075370_10034139 3300006353 Bacteria 2852
55 Ga0068871_100000496 3300006358 Bacteria 26925
56 Ga0075428_100007755 3300006844 Bacteria 11897
57 Ga0075428_100007951 3300006844 Bacteria 11763
58 Ga0075430_100002063 3300006846 Bacteria 16577
59 Ga0075430_100005300 3300006846 Bacteria 10881
60 Ga0075430_100014572 3300006846 Bacteria 6698
61 Ga0075431_100001582 3300006847 Bacteria 21175
62 Ga0075431_100003496 3300006847 Bacteria 15233
63 Ga0075431_100009162 3300006847 Bacteria 9926
64 Ga0075431_100113821 3300006847 Bacteria 2792
65 Ga0075433_10004517 3300006852 Bacteria 10847
66 Ga0075433_10027068 3300006852 Bacteria 4861
67 Ga0075434_100003553 3300006871 Bacteria 13917
68 Ga0075434_100006223 3300006871 Bacteria 10935
69 Ga0075434_100012678 3300006871 Bacteria 7995
70 Ga0075434_100113549 3300006871 Bacteria 2721
71 Ga0075429_100015366 3300006880 Bacteria 6635
72 Ga0075429_100089063 3300006880 Bacteria 2690
73 Ga0075429_100098940 3300006880 Bacteria 2545
74 Ga0075436_100000920 3300006914 Bacteria 19615
75 Ga0075436_100010676 3300006914 Bacteria 6299
76 Ga0075436_100019511 3300006914 Bacteria 4646
77 Ga0075436_100030872 3300006914 Bacteria 3688
78 Ga0097620_100095777 3300006931 Bacteria 3021
79 Ga0075435_100000723 3300007076 Bacteria 20481
80 Ga0075435_100002961 3300007076 Bacteria 11421
81 Ga0075435_100006585 3300007076 Bacteria 8222
82 Ga0075435_100020811 3300007076 Bacteria 5034
83 Ga0075435_100021753 3300007076 Bacteria 4939
84 Ga0105240_10058581 3300009093 Bacteria 4808
85 Ga0105240_10097892 3300009093 Bacteria 3574
86 Ga0111539_10001863 3300009094 Bacteria 28020
87 Ga0105247_10008307 3300009101 Bacteria 6331
88 Ga0114129_10000946 3300009147 Bacteria 37881
89 Ga0114129_10002937 3300009147 Bacteria 23854
90 Ga0114129_10022439 3300009147 Bacteria 8961
91 Ga0114129_10061501 3300009147 Bacteria 5247
92 Ga0105243_10016072 3300009148 Bacteria 5662
93 Ga0105242_10016958 3300009176 Bacteria 5669
94 Ga0105248_10027644 3300009177 Bacteria 6317
95 Ga0105248_10048849 3300009177 Bacteria 4746
96 Ga0105248_10057045 3300009177 Bacteria 4383
97 Ga0105248_10150823 3300009177 Bacteria 2622
98 Ga0105249_10000559 3300009553 Bacteria 34278
99 Ga0163162_10072074 3300013306 Bacteria 3509
100 Ga0163163_10066641 3300014325 Bacteria 3577
101 Ga0157380_10004299 3300014326 Bacteria 9872
102 Ga0157377_10008907 3300014745 Bacteria 4910
103 Ga0157376_10056732 3300014969 Bacteria 3274
104 Ga0207697_10007834 3300025315 Bacteria 4723
105 Ga0207682_10012382 3300025893 Bacteria 3330
106 Ga0207710_10007675 3300025900 Bacteria 4563
107 Ga0207688_10011669 3300025901 Bacteria 4778
108 Ga0207707_10019226 3300025912 Bacteria 5962
109 Ga0207662_10011013 3300025918 Bacteria 5004
110 Ga0207657_10005912 3300025919 Bacteria 12734
111 Ga0207649_10019297 3300025920 Bacteria 3895
112 Ga0207652_10150355 3300025921 Bacteria 2085
113 Ga0207681_10000533 3300025923 Bacteria 26280
114 Ga0207650_10017174 3300025925 Bacteria 5064
115 Ga0207650_10024221 3300025925 Bacteria 4312
116 Ga0207650_10127266 3300025925 Bacteria 1990
117 Ga0207687_10048661 3300025927 Bacteria 2946
118 Ga0207644_10010775 3300025931 Bacteria 6031
119 Ga0207706_10112038 3300025933 Bacteria 2400
120 Ga0207691_10082987 3300025940 Bacteria 2877
121 Ga0207711_10025728 3300025941 Bacteria 4935
122 Ga0207711_10088908 3300025941 Bacteria 2713
123 Ga0207661_10001610 3300025944 Bacteria 15363
124 Ga0207679_10001939 3300025945 Bacteria 12830
125 Ga0207679_10086104 3300025945 Bacteria 2416
126 Ga0207651_10008524 3300025960 Bacteria 5542
127 Ga0207651_10046241 3300025960 Bacteria 2925
128 Ga0207712_10003591 3300025961 Bacteria 9782
129 Ga0207640_10002813 3300025981 Bacteria 9328
130 Ga0207708_10016205 3300026075 Bacteria 5600
131 Ga0207702_10054195 3300026078 Bacteria 3398
132 Ga0207641_10030944 3300026088 Bacteria 4436
133 Ga0207648_10065095 3300026089 Bacteria 3178
134 Ga0207648_10112578 3300026089 Bacteria 2389
135 Ga0207676_10137748 3300026095 Bacteria 2085
136 Ga0207674_10108864 3300026116 Bacteria 2747
137 Ga0207675_100003680 3300026118 Bacteria 14943
138 Ga0207683_10055621 3300026121 Bacteria 3470
139 Ga0207683_10124183 3300026121 Bacteria 2319
140 Ga0207428_10014753 3300027907 Bacteria 6769
141 Ga0268265_10088388 3300028380 Bacteria 2469
142 Ga0307408_100028502 3300031548 Bacteria 3859
143 Ga0307416_100004791 3300032002 Bacteria 8220
144 Ga0307416_100123282 3300032002 Bacteria 2316
145 Ga0373948_0004761 3300034817 Bacteria 2165
146 Ga0373928_0002308 3300035084 Bacteria 3705
147 Ga0373952_0012751 3300035092 Bacteria 1658
148 Ga0373932_0000233 3300035112 Bacteria 16786
149 Ga0373939_0019581 3300035114 Bacteria 1827
150 Ga0373941_0003236 3300035115 Bacteria 3667
151 Ga0373961_0009637 3300035241 Bacteria 2366
152 Ga0373937_0003495 3300036401 Bacteria 13215
153 Ga0450894_002276 3300042131 Bacteria 2601
154 Ga0451577_0032887 3300042876 Bacteria 4675
155 Ga0453684_0039698 3300044712 Bacteria 6406
156 Ga0466967_0165022 3300045976 Bacteria 2081
157 Ga0496102_0030454 3300048905 Bacteria 4831
158 Ga0496104_0018205 3300048907 Bacteria 6406
159 Ga0496104_0027139 3300048907 Bacteria 5297
160 Ga0496104_0100352 3300048907 Bacteria 2771
161 Ga0496105_0022742 3300048908 Bacteria 5079
162 Ga0496105_0119297 3300048908 Bacteria 2176
163 Ga0496108_0006612 3300048911 Bacteria 9401
164 Ga0496109_0000914 3300048912 Bacteria 24543
165 Ga0496109_0077639 3300048912 Bacteria 3056
166 Ga0496110_0008686 3300048913 Bacteria 8181
167 Ga0496111_0074446 3300048914 Bacteria 2473
168 Ga0496112_0003596 3300048915 Bacteria 12898
169 Ga0496112_0033981 3300048915 Bacteria 4961
170 Ga0496113_0014652 3300048916 Bacteria 5359
171 Ga0496114_0074377 3300048917 Bacteria 2860
172 Ga0496115_0048567 3300048918 Bacteria 3395
173 Ga0501034_0028829 3300049571 Bacteria 5647
174 Ga0501037_0036926 3300049573 Bacteria 3600
175 Ga0501041_0054509 3300049577 Bacteria 2439
176 Ga0501042_0050004 3300049578 Bacteria 2982
177 Ga0501047_0001667 3300049581 Bacteria 21598
178 Ga0501071_0012160 3300049587 Bacteria 5825
179 Ga0501071_0021616 3300049587 Bacteria 4483
180 Ga0501072_0025450 3300049588 Bacteria 4610
181 Ga0501075_0024779 3300049591 Bacteria 4405
182 Ga0501075_0047079 3300049591 Bacteria 3241
183 Ga0501044_0005007 3300049823 Bacteria 14791
184 nmdc:mga00v17_35520_c1 3300050491 Bacteria 2967
185 nmdc:mga00v17_60580_c1 3300050491 Bacteria 2325
186 nmdc:mga0k408_1449_c1 3300050493 Bacteria 12819
187 nmdc:mga0k408_9966_c1 3300050493 Bacteria 5129
188 nmdc:mga07m45_31730_c1 3300050496 Bacteria 2928
189 nmdc:mga07m45_5839_c1 3300050496 Bacteria 6174
190 nmdc:mga05p37_5139_c1 3300050507 Bacteria 15340
191 nmdc:mga05p37_5703_c1 3300050507 Bacteria 14639
192 nmdc:mga05p37_62729_c1 3300050507 Bacteria 4574
193 nmdc:mga05p37_80255_c1 3300050507 Bacteria 4019
194 nmdc:mga09592_13056_c1 3300050508 Bacteria 6781
195 nmdc:mga09592_29591_c2 3300050508 Bacteria 4002
196 nmdc:mga0qj67_1183_c1 3300050509 Bacteria 18079
197 nmdc:mga06r32_4361_c1 3300050510 Bacteria 12653
198 nmdc:mga06r32_56422_c1 3300050510 Bacteria 3771
199 nmdc:mga08y16_3723_c1 3300050511 Bacteria 15877
200 nmdc:mga0n895_177_c1 3300050512 Bacteria 39316
201 nmdc:mga0n895_31465_c1 3300050512 Bacteria 5081
202 nmdc:mga0n895_97154_c1 3300050512 Bacteria 2951
203 nmdc:mga0rr50_36_c1 3300050513 Bacteria 89726
204 nmdc:mga0rr50_693_c1 3300050513 Bacteria 18015
205 nmdc:mga0rr50_7275_c1 3300050513 Bacteria 6812
206 nmdc:mga0rr50_84087_c1 3300050513 Bacteria 2463
207 nmdc:mga08x19_11885_c1 3300050514 Bacteria 5237
208 nmdc:mga08x19_567_c1 3300050514 Bacteria 24222
209 nmdc:mga0a205_28163_c1 3300050515 Bacteria 5370
210 nmdc:mga0a205_51710_c1 3300050515 Bacteria 3966
211 nmdc:mga0a205_5434_c1 3300050515 Bacteria 11481
212 Ga0495619_0032790 3300053085 Bacteria 3371
213 Ga0590071_000031 3300059421 Bacteria 36919
214 Ga0590071_002557 3300059421 Bacteria 4578
215 Ga0590075_000219 3300059424 Bacteria 15950
216 Ga0590075_001664 3300059424 Bacteria 5475
217 Ga0590075_001735 3300059424 Bacteria 5340
218 Ga0590077_000367 3300059426 Bacteria 12680
219 Ga0590077_000673 3300059426 Bacteria 9096
220 nmdc:mga0a205_90028_c1
221 Ga0065712_10001453
222 Ga0065712_10068034
223 Ga0065715_10007660
224 Ga0065715_10111732
225 Ga0065707_10092263
226 Ga0070683_100000193
227 Ga0070683_100096819
228 Ga0070690_100020536
229 Ga0070670_100011059
230 Ga0070670_100025222
231 Ga0070670_100075264
232 Ga0070687_100004242
233 Ga0070687_100005904
234 Ga0070661_100030865
235 Ga0070669_100002976
236 Ga0070669_100039705
237 Ga0070675_100016779
238 Ga0070671_100011259
239 Ga0070673_100001496
240 Ga0070673_100017448
241 Ga0070673_100076624
242 Ga0070688_100004458
243 Ga0070713_100004565
244 Ga0070681_10056112
245 Ga0068867_100104320
246 Ga0070685_10032730
247 Ga0070698_100094779
248 Ga0070679_100119879
249 Ga0070679_100166999
250 Ga0070684_100004130
251 Ga0070684_100066444
252 Ga0070686_100019043
253 Ga0070686_100027367
254 Ga0070665_100025234
255 Ga0068855_100002008
256 Ga0068855_100177176
257 Ga0070664_100002758
258 Ga0068857_100064381
259 Ga0068856_100062804
260 Ga0068859_100095776
261 Ga0068864_100007871
262 Ga0068858_100008481
263 Ga0081539_10032611
264 Ga0075368_10029280
265 Ga0075364_10023038
266 Ga0075362_10000517
267 Ga0075367_10014228
268 Ga0075366_10004151
269 Ga0075366_10024750
270 Ga0097621_100001248
271 Ga0097621_100019238
272 Ga0075370_10019353
273 Ga0075370_10034139
274 Ga0068871_100000496
275 Ga0075428_100007755
276 Ga0075428_100007951
277 Ga0075430_100002063
278 Ga0075430_100005300
279 Ga0075430_100014572
280 Ga0075431_100001582
281 Ga0075431_100003496
282 Ga0075431_100009162
283 Ga0075431_100113821
284 Ga0075433_10004517
285 Ga0075433_10027068
286 Ga0075434_100003553
287 Ga0075434_100006223
288 Ga0075434_100012678
289 Ga0075434_100113549
290 Ga0075429_100015366
291 Ga0075429_100089063
292 Ga0075429_100098940
293 Ga0075436_100000920
294 Ga0075436_100010676
295 Ga0075436_100019511
296 Ga0075436_100030872
297 Ga0097620_100095777
298 Ga0075435_100000723
299 Ga0075435_100002961
300 Ga0075435_100006585
301 Ga0075435_100020811
302 Ga0075435_100021753
303 Ga0105240_10058581
304 Ga0105240_10097892
305 Ga0111539_10001863
306 Ga0105247_10008307
307 Ga0114129_10000946
308 Ga0114129_10002937
309 Ga0114129_10022439
310 Ga0114129_10061501
311 Ga0105243_10016072
312 Ga0105242_10016958
313 Ga0105248_10027644
314 Ga0105248_10048849
315 Ga0105248_10057045
316 Ga0105248_10150823
317 Ga0105249_10000559
318 Ga0163162_10072074
319 Ga0163163_10066641
320 Ga0157380_10004299
321 Ga0157377_10008907
322 Ga0157376_10056732
323 Ga0207697_10007834
324 Ga0207682_10012382
325 Ga0207710_10007675
326 Ga0207688_10011669
327 Ga0207707_10019226
328 Ga0207662_10011013
329 Ga0207657_10005912
330 Ga0207649_10019297
331 Ga0207652_10150355
332 Ga0207681_10000533
333 Ga0207650_10017174
334 Ga0207650_10024221
335 Ga0207650_10127266
336 Ga0207687_10048661
337 Ga0207644_10010775
338 Ga0207706_10112038
339 Ga0207691_10082987
340 Ga0207711_10025728
341 Ga0207711_10088908
342 Ga0207661_10001610
343 Ga0207679_10001939
344 Ga0207679_10086104
345 Ga0207651_10008524
346 Ga0207651_10046241
347 Ga0207712_10003591
348 Ga0207640_10002813
349 Ga0207708_10016205
350 Ga0207702_10054195
351 Ga0207641_10030944
352 Ga0207648_10065095
353 Ga0207648_10112578
354 Ga0207676_10137748
355 Ga0207674_10108864
356 Ga0207675_100003680
357 Ga0207683_10055621
358 Ga0207683_10124183
359 Ga0207428_10014753
360 Ga0268265_10088388
361 Ga0307408_100028502
362 Ga0307416_100004791
363 Ga0307416_100123282
364 Ga0373948_0004761
365 Ga0373928_0002308
366 Ga0373952_0012751
367 Ga0373932_0000233
368 Ga0373939_0019581
369 Ga0373941_0003236
370 Ga0373961_0009637
371 Ga0373937_0003495
372 Ga0450894_002276
373 Ga0451577_0032887
374 Ga0453684_0039698
375 Ga0466967_0165022
376 Ga0496102_0030454
377 Ga0496104_0018205
378 Ga0496104_0027139
379 Ga0496104_0100352
380 Ga0496105_0022742
381 Ga0496105_0119297
382 Ga0496108_0006612
383 Ga0496109_0000914
384 Ga0496109_0077639
385 Ga0496110_0008686
386 Ga0496111_0074446
387 Ga0496112_0003596
388 Ga0496112_0033981
389 Ga0496113_0014652
390 Ga0496114_0074377
391 Ga0496115_0048567
392 Ga0501034_0028829
393 Ga0501037_0036926
394 Ga0501041_0054509
395 Ga0501042_0050004
396 Ga0501047_0001667
397 Ga0501071_0012160
398 Ga0501071_0021616
399 Ga0501072_0025450
400 Ga0501075_0024779
401 Ga0501075_0047079
402 Ga0501044_0005007
403 nmdc:mga00v17_35520_c1
404 nmdc:mga00v17_60580_c1
405 nmdc:mga0k408_1449_c1
406 nmdc:mga0k408_9966_c1
407 nmdc:mga07m45_31730_c1
408 nmdc:mga07m45_5839_c1
409 nmdc:mga05p37_5139_c1
410 nmdc:mga05p37_5703_c1
411 nmdc:mga05p37_62729_c1
412 nmdc:mga05p37_80255_c1
413 nmdc:mga09592_13056_c1
414 nmdc:mga09592_29591_c2
415 nmdc:mga0qj67_1183_c1
416 nmdc:mga06r32_4361_c1
417 nmdc:mga06r32_56422_c1
418 nmdc:mga08y16_3723_c1
419 nmdc:mga0n895_177_c1
420 nmdc:mga0n895_31465_c1
421 nmdc:mga0n895_97154_c1
422 nmdc:mga0rr50_36_c1
423 nmdc:mga0rr50_693_c1
424 nmdc:mga0rr50_7275_c1
425 nmdc:mga0rr50_84087_c1
426 nmdc:mga08x19_11885_c1
427 nmdc:mga08x19_567_c1
428 nmdc:mga0a205_28163_c1
429 nmdc:mga0a205_51710_c1
430 nmdc:mga0a205_5434_c1
431 Ga0495619_0032790
432 Ga0590071_000031
433 Ga0590071_002557
434 Ga0590075_000219
435 Ga0590075_001664
436 Ga0590075_001735
437 Ga0590077_000367
438 Ga0590077_000673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00664

ABC_membrane

ABC transporter transmembrane region

32

303

0.99

PF00005

ABC_tran

ABC transporter

430

579

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ghi-assembly4.cif.gz_D crystal structure of plasmodium yoelii multidrug resistance protein 2 0.9213 346 584
7met-assembly1.cif.gz_B a. baumannii msba in complex with tbt1 decoupler 0.9087 20 583
4q7l-assembly3.cif.gz_C structure of nbd288 of tm287/288 0.9017 348 586
2ghi-assembly4.cif.gz_D crystal structure of plasmodium yoelii multidrug resistance protein 2 0.9015 346 584
7sel-assembly1.cif.gz_A e. coli msba in complex with lps and inhibitor g7090 (compound 3) 0.9011 8 584
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9502 345 414 3.40.50.300
af_A0A0P0VTT5_46_316_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9438 340 576 3.40.50.300
af_A0A0P0WTU4_134_342_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9353 379 572 3.40.50.300
af_A0A0P0WA26_474_616_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9336 429 568 3.40.50.300
af_Q54NL1_1088_1337_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9328 343 573 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A531KBA0-F1-model_v4 deleted 0.951 324 547
AF-A0A820QZT0-F1-model_v4 ABC transporter domain-containing protein 0.9445 401 572 GO:0005524
GO:0016020
GO:0016887
GO:0042626
AF-A0A531KBA0-F1-model_v4 deleted 0.9347 324 547
AF-A0A6P5YJY7-F1-model_v4 ABC transporter B family member 26, chloroplastic-like isoform X3 0.9322 17 520 GO:0005524
GO:0015421
GO:0016020
GO:0016887
AF-A0A1M6DMU5-F1-model_v4 ATP-binding cassette, subfamily B 0.9313 15 527 GO:0005524
GO:0005886
GO:0015421
GO:0016887

Map