F331542

General Info

Members Datasets Scaffolds Average Seq Length
219 186 200 264

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0142127|Ga0501043_0142127_492_1394
Length 300
Sequence MEPGATPGPPILPASCLDSAARFRSKFDKCALAGNCLAVNLHLENKLALVTGSTKGIGLAIATSLAREKARVIVNGRGEKSVTDALAKIRGAVPHAQLESFPGDLSAAAGAAALVQKFPAVDILVNNLGIFEPKPFEEIPDADWQRFFDVNVLSGVRLSRAYFPVMKKNNWGRIVFISSESGLQIPAEMIHYGMTKTAQIAVARGLAELSAGTGVTVNAVLPGPTRSDGVDEFVNKLSGGKPFAEFEKEFFEKHRPTSLIKRFATTEEVANLVTYVCSPLSSATNGAALRVDGGVVKSAF

Samples

Sample ID Description Type Environment
1 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
2 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2765235841 Pseudomonas putida AA7 Isolate Unclassified
6 2831864461 Roseateles noduli HZ7 Isolate Nodule
7 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
8 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
9 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
10 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
11 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
12 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
13 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
14 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
107 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
108 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
119 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
172 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
175 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
176 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
177 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
182 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
183 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
184 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
185 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
186 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.41
Metatranscriptomes 0.91
Isolates 8.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.35
Nodule 1.37
Rhizoplane 3.65
Rhizosphere 67.58
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10030548 3300001989 Bacteria 1867
2 JGI25162J39368_1000070 3300002737 Bacteria 124571
3 JGI25163J39215_1000044 3300002771 Bacteria 55219
4 JGI25164J39214_1000047 3300002772 Bacteria 124571
5 JGI25150J39212_1016019 3300002774 Bacteria 1237
6 JGI25165J46597_1000132 3300003214 Bacteria 124736
7 rootH1_10000553 3300003316 Bacteria 12668
8 rootL2_10008970 3300003322 Bacteria 11102
9 Ga0055526_1002453 3300003771 Bacteria 12538
10 Ga0055537_1005075 3300003773 Bacteria 3603
11 Ga0055524_1007983 3300003775 Bacteria 4441
12 Ga0055536_1028882 3300003781 Bacteria 1502
13 Ga0055534_1010100 3300003784 Bacteria 2001
14 Ga0055530_10000078 3300003791 Bacteria 83740
15 Ga0065165_1001247 3300005262 Bacteria 28997
16 Ga0070670_100674590 3300005331 Bacteria 928
17 Ga0070660_100202488 3300005339 Bacteria 1610
18 Ga0070667_100065511 3300005367 Bacteria 3085
19 Ga0070667_100135488 3300005367 Bacteria 2153
20 Ga0070663_100020983 3300005455 Bacteria 4335
21 Ga0070662_100491882 3300005457 Bacteria 1022
22 Ga0070681_10049085 3300005458 Bacteria 4216
23 Ga0070707_100031485 3300005468 Bacteria 5053
24 Ga0070679_100171532 3300005530 Bacteria 2142
25 Ga0070696_100000620 3300005546 Bacteria 22785
26 Ga0070665_100652081 3300005548 Bacteria 1066
27 Ga0068855_100002524 3300005563 Bacteria 22545
28 Ga0068854_100221183 3300005578 Bacteria 1498
29 Ga0068856_100115672 3300005614 Bacteria 2682
30 Ga0068852_100312302 3300005616 Bacteria 1524
31 Ga0068870_10273923 3300005840 Bacteria 1055
32 Ga0068863_100106309 3300005841 Bacteria 2670
33 Ga0068860_100429357 3300005843 Bacteria 1311
34 Ga0075366_10010988 3300006195 Bacteria 5098
35 Ga0097621_100027355 3300006237 Bacteria 4483
36 Ga0075370_10012008 3300006353 Bacteria 4565
37 Ga0068871_100023099 3300006358 Bacteria 4803
38 Ga0099795_10058481 3300007788 Bacteria 1423
39 Ga0105251_10000044 3300009011 Bacteria 113730
40 Ga0105251_10011310 3300009011 Bacteria 5106
41 Ga0105244_10061833 3300009036 Bacteria 1883
42 Ga0105250_10000092 3300009092 Bacteria 79976
43 Ga0105240_10438938 3300009093 Bacteria 1463
44 Ga0105241_10002004 3300009174 Bacteria 15406
45 Ga0105248_10032478 3300009177 Bacteria 5834
46 Ga0105237_10510959 3300009545 Bacteria 1208
47 Ga0105238_10013827 3300009551 Bacteria 8159
48 Ga0105238_10026586 3300009551 Bacteria 5901
49 Ga0099796_10000226 3300010159 Bacteria 8819
50 Ga0099796_10102793 3300010159 Bacteria 1077
51 Ga0105239_10019785 3300010375 Bacteria 7430
52 Ga0163162_10016022 3300013306 Bacteria 7326
53 Ga0157375_10017090 3300013308 Bacteria 6538
54 Ga0157375_10071191 3300013308 Bacteria 3490
55 Ga0182008_10003748 3300014497 Bacteria 9052
56 Ga0157376_10159133 3300014969 Bacteria 2045
57 Ga0213872_10004360 3300021361 Bacteria 7532
58 Ga0213872_10006544 3300021361 Bacteria 5828
59 Ga0209760_100042 3300025207 Bacteria 114037
60 Ga0207427_100004 3300025231 Bacteria 939600
61 Ga0209437_100011 3300025233 Bacteria 818520
62 Ga0209233_1000019 3300025261 Bacteria 818520
63 Ga0209565_1003265 3300025263 Bacteria 5342
64 Ga0209675_1003838 3300025291 Bacteria 6929
65 Ga0209676_1001035 3300025292 Bacteria 32260
66 Ga0209564_1000124 3300025295 Bacteria 202046
67 Ga0209050_1000313 3300025298 Bacteria 98580
68 Ga0209256_1002005 3300025299 Bacteria 18213
69 Ga0207696_1000225 3300025711 Bacteria 79995
70 Ga0207713_1000113 3300025735 Bacteria 132424
71 Ga0207713_1006957 3300025735 Bacteria 6785
72 Ga0207705_10121827 3300025909 Bacteria 1936
73 Ga0207684_10096488 3300025910 Bacteria 2523
74 Ga0207654_10149348 3300025911 Bacteria 1498
75 Ga0207707_10079175 3300025912 Bacteria 2869
76 Ga0207695_10145527 3300025913 Bacteria 2314
77 Ga0207671_10364427 3300025914 Bacteria 1147
78 Ga0207657_10400759 3300025919 Bacteria 1079
79 Ga0207646_10020621 3300025922 Bacteria 6104
80 Ga0207694_10053459 3300025924 Bacteria 3132
81 Ga0207694_10138340 3300025924 Bacteria 1957
82 Ga0207711_10046577 3300025941 Bacteria 3705
83 Ga0207711_10312231 3300025941 Bacteria 1452
84 Ga0207667_10035164 3300025949 Bacteria 5375
85 Ga0207667_10159534 3300025949 Bacteria 2320
86 Ga0207658_10172346 3300025986 Bacteria 1784
87 Ga0207639_10003039 3300026041 Bacteria 11298
88 Ga0207639_10072035 3300026041 Bacteria 2705
89 Ga0207702_10208210 3300026078 Bacteria 1817
90 Ga0207702_10239729 3300026078 Bacteria 1698
91 Ga0207641_10050575 3300026088 Bacteria 3516
92 Ga0207641_10286904 3300026088 Bacteria 1550
93 Ga0207674_10023981 3300026116 Bacteria 6525
94 Ga0207698_10520440 3300026142 Bacteria 1161
95 Ga0265354_1003072 3300028016 Bacteria 1928
96 Ga0268266_10011514 3300028379 Bacteria 7680
97 Ga0268266_10587219 3300028379 Bacteria 1069
98 Ga0268264_10189472 3300028381 Bacteria 1874
99 Ga0307517_10257096 3300028786 Bacteria 1018
100 Ga0307515_10286025 3300028794 Bacteria 1350
101 Ga0265762_1012369 3300030760 Bacteria 1530
102 Ga0265760_10002092 3300031090 Bacteria 5859
103 Ga0265327_10001335 3300031251 Bacteria 31984
104 Ga0307408_100000022 3300031548 Bacteria 310242
105 Ga0307408_100000071 3300031548 Bacteria 116933
106 Ga0307516_10000012 3300031730 Bacteria 224120
107 Ga0307516_10108183 3300031730 Bacteria 2588
108 Ga0373948_0010138 3300034817 Bacteria 1639
109 Ga0373928_0000742 3300035084 Bacteria 6391
110 Ga0373939_0000086 3300035114 Bacteria 29575
111 Ga0373960_0000504 3300035121 Bacteria 7792
112 Ga0373931_0001184 3300035691 Bacteria 11142
113 Ga0373937_0532418 3300036401 Bacteria 1116
114 Ga0395900_0151265 3300037418 Bacteria 2371
115 Ga0395900_0573796 3300037418 Bacteria 1070
116 Ga0395898_0038237 3300037466 Bacteria 4757
117 Ga0395905_0000210 3300037471 Bacteria 90096
118 Ga0395901_0097398 3300038443 Bacteria 3083
119 Ga0451789_0388568 3300041443 Bacteria 2152
120 Ga0451800_0467963 3300041459 Bacteria 1127
121 Ga0451804_0147516 3300041463 Bacteria 1258
122 Ga0439456_000018 3300042013 Bacteria 62369
123 Ga0451577_0103998 3300042876 Bacteria 2538
124 Ga0466968_0010454 3300044735 Bacteria 3599
125 Ga0495592_0176580 3300046454 Bacteria 1458
126 Ga0495638_0134869 3300046460 Bacteria 1447
127 Ga0495650_0032785 3300046471 Bacteria 2319
128 Ga0495605_0124893 3300046474 Bacteria 1164
129 Ga0495608_0125464 3300046511 Bacteria 1644
130 Ga0495618_0087345 3300046514 Bacteria 1994
131 Ga0495618_0182277 3300046514 Bacteria 1334
132 Ga0495628_0001330 3300046516 Bacteria 22682
133 Ga0495652_0013010 3300046529 Bacteria 7499
134 Ga0495645_0384350 3300046543 Bacteria 897
135 Ga0495656_0000001 3300046615 Bacteria 410042
136 Ga0495635_0055107 3300046663 Bacteria 2739
137 Ga0495659_0000217 3300046664 Bacteria 24701
138 Ga0495623_0042778 3300046679 Bacteria 2884
139 Ga0495646_0058552 3300046680 Bacteria 2303
140 Ga0495624_0006025 3300046690 Bacteria 8645
141 Ga0495670_0039034 3300046691 Bacteria 2368
142 Ga0495589_0083233 3300046794 Bacteria 1555
143 Ga0495600_0001683 3300046809 Bacteria 12350
144 Ga0495604_0009622 3300047317 Bacteria 7645
145 Ga0495672_0000088 3300047320 Bacteria 153860
146 Ga0495602_0192465 3300048088 Bacteria 1562
147 Ga0496102_0023622 3300048905 Bacteria 5463
148 Ga0496104_0449547 3300048907 Bacteria 1200
149 Ga0496107_0085461 3300048910 Bacteria 2302
150 Ga0496110_0022006 3300048913 Bacteria 5408
151 Ga0496115_0249391 3300048918 Bacteria 1462
152 Ga0496121_0001541 3300048924 Bacteria 38568
153 Ga0496124_0002186 3300048927 Bacteria 26111
154 Ga0496124_0416471 3300048927 Bacteria 927
155 Ga0496125_0118192 3300048928 Bacteria 1899
156 Ga0496126_0015220 3300048929 Bacteria 7745
157 Ga0496126_0021244 3300048929 Bacteria 6344
158 Ga0501031_0000129 3300049568 Bacteria 42023
159 Ga0501032_0021260 3300049569 Bacteria 4512
160 Ga0501032_0145507 3300049569 Bacteria 1560
161 Ga0501033_0007479 3300049570 Bacteria 8505
162 Ga0501033_0041993 3300049570 Bacteria 3410
163 Ga0501033_0045152 3300049570 Bacteria 3280
164 Ga0501036_0170533 3300049572 Bacteria 1834
165 Ga0501037_0009382 3300049573 Bacteria 7183
166 Ga0501037_0167917 3300049573 Bacteria 1561
167 Ga0501038_0076822 3300049574 Bacteria 2821
168 Ga0501038_0252784 3300049574 Bacteria 1395
169 Ga0501043_0142127 3300049579 Bacteria 1879
170 Ga0501046_0096262 3300049580 Bacteria 2274
171 Ga0501046_0208647 3300049580 Bacteria 1451
172 Ga0501047_0149483 3300049581 Bacteria 2212
173 Ga0501068_0280820 3300049584 Bacteria 1064
174 Ga0501069_0068172 3300049585 Bacteria 1991
175 Ga0501070_0099088 3300049586 Bacteria 2411
176 Ga0501070_0546138 3300049586 Bacteria 928
177 Ga0501073_0272063 3300049589 Bacteria 1169
178 Ga0501074_0083868 3300049590 Bacteria 2285
179 Ga0501035_0004409 3300049822 Bacteria 13359
180 Ga0501035_0084925 3300049822 Bacteria 2791
181 Ga0501044_0000713 3300049823 Bacteria 40074
182 Ga0501044_0007688 3300049823 Bacteria 11851
183 Ga0501044_0089457 3300049823 Bacteria 3107
184 Ga0501044_0374236 3300049823 Bacteria 1340
185 Ga0501044_0720837 3300049823 Bacteria 881
186 nmdc:mga0k408_38605_c1 3300050493 Bacteria 2741
187 nmdc:mga07m45_873_c1 3300050496 Bacteria 13139
188 Ga0495601_0001480 3300053077 Bacteria 12956
189 Ga0500643_000420 3300053087 Bacteria 32288
190 Ga0500646_0002599 3300053090 Bacteria 4681
191 Ga0500641_0000140 3300053096 Bacteria 26611
192 Ga0500593_206254 3300053117 Bacteria 704
193 Ga0500642_0006672 3300053130 Bacteria 3821
194 Ga0500652_075708 3300053131 Bacteria 1398
195 Ga0500574_063454 3300053141 Bacteria 1075
196 Ga0500616_0004927 3300053153 Bacteria 9274
197 Ga0500619_003223 3300053154 Bacteria 3301
198 Ga0500622_0000011 3300053156 Bacteria 386096
199 Ga0500622_0107026 3300053156 Bacteria 1370
200 Ga0500645_000313 3300053730 Bacteria 34585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2909399089 2909403375 211
2 3300041459 Ga0451800_0467963 Ga0451800_0467963_53_694 213
3 3300053117 Ga0500593_206254 Ga0500593_206254_43_684 213
4 3300002774 JGI25150J39212_1016019 JGI25150J39212_10160191 224
5 3300031251 Ga0265327_10001335 Ga0265327_1000133513 240
6 3300049580 Ga0501046_0208647 Ga0501046_0208647_247_1041 247
7 3300006195 Ga0075366_10010988 Ga0075366_100109885 249
8 3300025941 Ga0207711_10312231 Ga0207711_103122312 249
9 3300050493 nmdc:mga0k408_38605_c1 nmdc:mga0k408_38605_c1_1432_2226 249
10 3300048088 Ga0495602_0192465 Ga0495602_0192465_28_789 252
11 3300037418 Ga0395900_0573796 Ga0395900_0573796_160_1059 255
12 3300046454 Ga0495592_0176580 Ga0495592_0176580_484_1353 256
13 3300046511 Ga0495608_0125464 Ga0495608_0125464_704_1498 256
14 3300046514 Ga0495618_0087345 Ga0495618_0087345_154_1023 256
15 3300046514 Ga0495618_0182277 Ga0495618_0182277_68_862 256
16 3300046516 Ga0495628_0001330 Ga0495628_0001330_7770_8564 256
17 3300046529 Ga0495652_0013010 Ga0495652_0013010_2286_3080 256
18 3300046543 Ga0495645_0384350 Ga0495645_0384350_41_835 256
19 3300046663 Ga0495635_0055107 Ga0495635_0055107_1731_2600 256
20 3300046679 Ga0495623_0042778 Ga0495623_0042778_887_1756 256
21 3300046680 Ga0495646_0058552 Ga0495646_0058552_1082_1951 256
22 3300046690 Ga0495624_0006025 Ga0495624_0006025_1973_2842 256
23 3300046809 Ga0495600_0001683 Ga0495600_0001683_4485_5354 256
24 3300047317 Ga0495604_0009622 Ga0495604_0009622_1841_2710 256
25 3300053077 Ga0495601_0001480 Ga0495601_0001480_7333_8202 256
26 3300053141 Ga0500574_063454 Ga0500574_063454_262_1056 256
27 3300053154 Ga0500619_003223 Ga0500619_003223_2336_3205 256
28 iso_pu_bacteria 2595698237 2596372514 257
29 iso_pu_bacteria 2643221639 2644220118 257
30 iso_pu_bacteria 2643221646 2644261130 257
31 iso_pu_bacteria 2889306138 2889308499 257
32 iso_pu_bacteria 2902405164 2902410644 257
33 iso_pu_bacteria 2928125067 2928127692 257
34 3300049573 Ga0501037_0009382 Ga0501037_0009382_3248_4042 258
35 iso_pu_bacteria 2588253510 2588290812 259
36 iso_pu_bacteria 2765235841 2765585901 259
37 iso_pu_bacteria 2831864461 2831869630 259
38 iso_pu_bacteria 2912963787 2912968197 259
39 iso_pu_bacteria 3007803356 3007806401 259
40 iso_pu_bacteria 641228493 641335835 259
41 iso_pu_bacteria 643348555 643389643 259
42 iso_pu_bacteria 8054929484 8054933025 259
43 iso_pu_bacteria 8055878733 8055883726 259
44 iso_pu_bacteria 8056115690 8056117203 259
45 3300003316 rootH1_10000553 rootH1_100005536 261
46 3300003322 rootL2_10008970 rootL2_100089709 261
47 3300005331 Ga0070670_100674590 Ga0070670_1006745901 261
48 3300005339 Ga0070660_100202488 Ga0070660_1002024882 261
49 3300005367 Ga0070667_100065511 Ga0070667_1000655111 261
50 3300005367 Ga0070667_100135488 Ga0070667_1001354882 261
51 3300005455 Ga0070663_100020983 Ga0070663_1000209832 261
52 3300005457 Ga0070662_100491882 Ga0070662_1004918821 261
53 3300005458 Ga0070681_10049085 Ga0070681_100490851 261
54 3300005468 Ga0070707_100031485 Ga0070707_1000314854 261
55 3300005530 Ga0070679_100171532 Ga0070679_1001715322 261
56 3300005548 Ga0070665_100652081 Ga0070665_1006520811 261
57 3300005563 Ga0068855_100002524 Ga0068855_1000025247 261
58 3300005578 Ga0068854_100221183 Ga0068854_1002211832 261
59 3300005614 Ga0068856_100115672 Ga0068856_1001156722 261
60 3300005840 Ga0068870_10273923 Ga0068870_102739231 261
61 3300005841 Ga0068863_100106309 Ga0068863_1001063092 261
62 3300005843 Ga0068860_100429357 Ga0068860_1004293572 261
63 3300006237 Ga0097621_100027355 Ga0097621_1000273553 261
64 3300006353 Ga0075370_10012008 Ga0075370_100120082 261
65 3300006358 Ga0068871_100023099 Ga0068871_1000230994 261
66 3300009036 Ga0105244_10061833 Ga0105244_100618332 261
67 3300009174 Ga0105241_10002004 Ga0105241_100020047 261
68 3300009177 Ga0105248_10032478 Ga0105248_100324782 261
69 3300009545 Ga0105237_10510959 Ga0105237_105109591 261
70 3300009551 Ga0105238_10013827 Ga0105238_100138276 261
71 3300009551 Ga0105238_10026586 Ga0105238_100265862 261
72 3300010375 Ga0105239_10019785 Ga0105239_100197856 261
73 3300013306 Ga0163162_10016022 Ga0163162_100160224 261
74 3300013308 Ga0157375_10017090 Ga0157375_100170908 261
75 3300013308 Ga0157375_10071191 Ga0157375_100711914 261
76 3300014969 Ga0157376_10159133 Ga0157376_101591333 261
77 3300025910 Ga0207684_10096488 Ga0207684_100964882 261
78 3300025911 Ga0207654_10149348 Ga0207654_101493482 261
79 3300025912 Ga0207707_10079175 Ga0207707_100791753 261
80 3300025914 Ga0207671_10364427 Ga0207671_103644271 261
81 3300025919 Ga0207657_10400759 Ga0207657_104007591 261
82 3300025922 Ga0207646_10020621 Ga0207646_100206217 261
83 3300025924 Ga0207694_10053459 Ga0207694_100534593 261
84 3300025924 Ga0207694_10138340 Ga0207694_101383401 261
85 3300025941 Ga0207711_10046577 Ga0207711_100465774 261
86 3300025949 Ga0207667_10035164 Ga0207667_100351645 261
87 3300025949 Ga0207667_10159534 Ga0207667_101595342 261
88 3300025986 Ga0207658_10172346 Ga0207658_101723462 261
89 3300026041 Ga0207639_10003039 Ga0207639_100030396 261
90 3300026041 Ga0207639_10072035 Ga0207639_100720351 261
91 3300026078 Ga0207702_10208210 Ga0207702_102082103 261
92 3300026078 Ga0207702_10239729 Ga0207702_102397291 261
93 3300026088 Ga0207641_10050575 Ga0207641_100505753 261
94 3300026088 Ga0207641_10286904 Ga0207641_102869041 261
95 3300026116 Ga0207674_10023981 Ga0207674_100239818 261
96 3300026142 Ga0207698_10520440 Ga0207698_105204401 261
97 3300028379 Ga0268266_10011514 Ga0268266_100115146 261
98 3300028379 Ga0268266_10587219 Ga0268266_105872192 261
99 3300028381 Ga0268264_10189472 Ga0268264_101894723 261
100 3300030760 Ga0265762_1012369 Ga0265762_10123692 261
101 3300034817 Ga0373948_0010138 Ga0373948_0010138_492_1277 261
102 3300035084 Ga0373928_0000742 Ga0373928_0000742_4131_4919 261
103 3300035114 Ga0373939_0000086 Ga0373939_0000086_8112_8897 261
104 3300035121 Ga0373960_0000504 Ga0373960_0000504_1674_2459 261
105 3300035691 Ga0373931_0001184 Ga0373931_0001184_2847_3632 261
106 3300036401 Ga0373937_0532418 Ga0373937_0532418_204_995 261
107 3300037466 Ga0395898_0038237 Ga0395898_0038237_324_1121 261
108 3300042876 Ga0451577_0103998 Ga0451577_0103998_1465_2256 261
109 3300044735 Ga0466968_0010454 Ga0466968_0010454_607_1404 261
110 3300046474 Ga0495605_0124893 Ga0495605_0124893_347_1135 261
111 3300046691 Ga0495670_0039034 Ga0495670_0039034_1317_2105 261
112 3300046794 Ga0495589_0083233 Ga0495589_0083233_740_1528 261
113 3300048905 Ga0496102_0023622 Ga0496102_0023622_878_1666 261
114 3300048907 Ga0496104_0449547 Ga0496104_0449547_34_822 261
115 3300048918 Ga0496115_0249391 Ga0496115_0249391_39_827 261
116 3300049568 Ga0501031_0000129 Ga0501031_0000129_1343_2131 261
117 3300049569 Ga0501032_0021260 Ga0501032_0021260_2160_2948 261
118 3300049569 Ga0501032_0145507 Ga0501032_0145507_665_1453 261
119 3300049570 Ga0501033_0007479 Ga0501033_0007479_5996_6784 261
120 3300049570 Ga0501033_0045152 Ga0501033_0045152_72_974 261
121 3300049579 Ga0501043_0142127 Ga0501043_0142127_492_1394 261
122 3300049585 Ga0501069_0068172 Ga0501069_0068172_164_961 261
123 3300049822 Ga0501035_0004409 Ga0501035_0004409_1045_1833 261
124 3300049822 Ga0501035_0084925 Ga0501035_0084925_1035_1937 261
125 3300049823 Ga0501044_0000713 Ga0501044_0000713_37746_38534 261
126 3300049823 Ga0501044_0007688 Ga0501044_0007688_4333_5235 261
127 3300050496 nmdc:mga07m45_873_c1 nmdc:mga07m45_873_c1_9403_10188 261
128 3300053087 Ga0500643_000420 Ga0500643_000420_24923_25708 261
129 3300053096 Ga0500641_0000140 Ga0500641_0000140_8539_9324 261
130 3300053153 Ga0500616_0004927 Ga0500616_0004927_1407_2192 261
131 3300053730 Ga0500645_000313 Ga0500645_000313_18811_19596 261
132 3300005616 Ga0068852_100312302 Ga0068852_1003123023 262
133 3300046471 Ga0495650_0032785 Ga0495650_0032785_664_1452 262
134 3300053156 Ga0500622_0000011 Ga0500622_0000011_244864_245652 262
135 3300001989 JGI24739J22299_10030548 JGI24739J22299_100305482 263
136 3300002737 JGI25162J39368_1000070 JGI25162J39368_100007034 263
137 3300002771 JGI25163J39215_1000044 JGI25163J39215_100004422 263
138 3300002772 JGI25164J39214_1000047 JGI25164J39214_100004786 263
139 3300003214 JGI25165J46597_1000132 JGI25165J46597_100013234 263
140 3300003771 Ga0055526_1002453 Ga0055526_10024534 263
141 3300003773 Ga0055537_1005075 Ga0055537_10050752 263
142 3300003775 Ga0055524_1007983 Ga0055524_10079831 263
143 3300003781 Ga0055536_1028882 Ga0055536_10288821 263
144 3300003784 Ga0055534_1010100 Ga0055534_10101003 263
145 3300003791 Ga0055530_10000078 Ga0055530_1000007857 263
146 3300005262 Ga0065165_1001247 Ga0065165_100124724 263
147 3300005546 Ga0070696_100000620 Ga0070696_10000062010 263
148 3300007788 Ga0099795_10058481 Ga0099795_100584811 263
149 3300009011 Ga0105251_10000044 Ga0105251_1000004445 263
150 3300009011 Ga0105251_10011310 Ga0105251_100113104 263
151 3300009092 Ga0105250_10000092 Ga0105250_1000009234 263
152 3300009093 Ga0105240_10438938 Ga0105240_104389382 263
153 3300010159 Ga0099796_10000226 Ga0099796_100002269 263
154 3300010159 Ga0099796_10102793 Ga0099796_101027931 263
155 3300014497 Ga0182008_10003748 Ga0182008_100037482 263
156 3300021361 Ga0213872_10004360 Ga0213872_100043608 263
157 3300021361 Ga0213872_10006544 Ga0213872_100065443 263
158 3300025207 Ga0209760_100042 Ga0209760_10004253 263
159 3300025231 Ga0207427_100004 Ga0207427_100004775 263
160 3300025233 Ga0209437_100011 Ga0209437_10001165 263
161 3300025261 Ga0209233_1000019 Ga0209233_100001965 263
162 3300025263 Ga0209565_1003265 Ga0209565_10032655 263
163 3300025291 Ga0209675_1003838 Ga0209675_10038386 263
164 3300025292 Ga0209676_1001035 Ga0209676_100103523 263
165 3300025295 Ga0209564_1000124 Ga0209564_1000124137 263
166 3300025298 Ga0209050_1000313 Ga0209050_100031358 263
167 3300025299 Ga0209256_1002005 Ga0209256_10020058 263
168 3300025711 Ga0207696_1000225 Ga0207696_100022535 263
169 3300025735 Ga0207713_1000113 Ga0207713_100011363 263
170 3300025735 Ga0207713_1006957 Ga0207713_10069574 263
171 3300025909 Ga0207705_10121827 Ga0207705_101218272 263
172 3300025913 Ga0207695_10145527 Ga0207695_101455272 263
173 3300028016 Ga0265354_1003072 Ga0265354_10030722 263
174 3300028786 Ga0307517_10257096 Ga0307517_102570961 263
175 3300028794 Ga0307515_10286025 Ga0307515_102860251 263
176 3300031090 Ga0265760_10002092 Ga0265760_100020924 263
177 3300031548 Ga0307408_100000022 Ga0307408_10000002248 263
178 3300031548 Ga0307408_100000071 Ga0307408_10000007156 263
179 3300031730 Ga0307516_10000012 Ga0307516_10000012100 263
180 3300031730 Ga0307516_10108183 Ga0307516_101081832 263
181 3300037418 Ga0395900_0151265 Ga0395900_0151265_866_1660 263
182 3300037471 Ga0395905_0000210 Ga0395905_0000210_67535_68326 263
183 3300038443 Ga0395901_0097398 Ga0395901_0097398_1493_2287 263
184 3300041443 Ga0451789_0388568 Ga0451789_0388568_552_1343 263
185 3300041463 Ga0451804_0147516 Ga0451804_0147516_15_806 263
186 3300042013 Ga0439456_000018 Ga0439456_000018_2700_3494 263
187 3300046460 Ga0495638_0134869 Ga0495638_0134869_465_1361 263
188 3300046615 Ga0495656_0000001 Ga0495656_0000001_390221_391015 263
189 3300046664 Ga0495659_0000217 Ga0495659_0000217_5870_6664 263
190 3300047320 Ga0495672_0000088 Ga0495672_0000088_41944_42840 263
191 3300048910 Ga0496107_0085461 Ga0496107_0085461_958_1752 263
192 3300048913 Ga0496110_0022006 Ga0496110_0022006_3699_4493 263
193 3300048924 Ga0496121_0001541 Ga0496121_0001541_34352_35146 263
194 3300048927 Ga0496124_0002186 Ga0496124_0002186_18790_19584 263
195 3300048927 Ga0496124_0416471 Ga0496124_0416471_73_867 263
196 3300048928 Ga0496125_0118192 Ga0496125_0118192_1018_1812 263
197 3300048929 Ga0496126_0015220 Ga0496126_0015220_215_1009 263
198 3300048929 Ga0496126_0021244 Ga0496126_0021244_4326_5120 263
199 3300049570 Ga0501033_0041993 Ga0501033_0041993_2141_2935 263
200 3300049572 Ga0501036_0170533 Ga0501036_0170533_746_1540 263
201 3300049573 Ga0501037_0167917 Ga0501037_0167917_605_1399 263
202 3300049574 Ga0501038_0076822 Ga0501038_0076822_505_1299 263
203 3300049574 Ga0501038_0252784 Ga0501038_0252784_22_816 263
204 3300049580 Ga0501046_0096262 Ga0501046_0096262_30_824 263
205 3300049581 Ga0501047_0149483 Ga0501047_0149483_1239_2033 263
206 3300049584 Ga0501068_0280820 Ga0501068_0280820_78_872 263
207 3300049586 Ga0501070_0099088 Ga0501070_0099088_1483_2277 263
208 3300049586 Ga0501070_0546138 Ga0501070_0546138_70_864 263
209 3300049589 Ga0501073_0272063 Ga0501073_0272063_297_1091 263
210 3300049590 Ga0501074_0083868 Ga0501074_0083868_1311_2105 263
211 3300049823 Ga0501044_0089457 Ga0501044_0089457_999_1793 263
212 3300049823 Ga0501044_0374236 Ga0501044_0374236_337_1131 263
213 3300049823 Ga0501044_0720837 Ga0501044_0720837_49_843 263
214 3300053090 Ga0500646_0002599 Ga0500646_0002599_170_961 263
215 3300053130 Ga0500642_0006672 Ga0500642_0006672_76_867 263
216 3300053131 Ga0500652_075708 Ga0500652_075708_165_1049 263
217 3300053156 Ga0500622_0107026 Ga0500622_0107026_549_1340 263
218 iso_pu_bacteria 2842324504 2842326463 263
219 iso_pu_bacteria 2842454564 2842455773 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

238

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

296

0.89

PF08659

KR

KR domain

47

220

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g9m-assembly1.cif.gz_A acinetobacter_baumannii short-chain dehydrogenase 0.9586 1 256
8g9m-assembly1.cif.gz_A acinetobacter_baumannii short-chain dehydrogenase 0.9499 1 256
5t2u-assembly1.cif.gz_B short chain dehydrogenase/reductase family protein 0.9319 1 257
4m8s-assembly1.cif.gz_D crystal structure of 3-ketoacyl -(acyl carrier protein) reductase (fabg) from neisseria meningitidis 0.9246 1 253
2z1n-assembly2.cif.gz_B crystal structure of ape0912 from aeropyrum pernix k1 0.9213 1 257
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9702 3 78 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9496 90 189 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9444 2 184 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9346 5 159 3.40.50.720
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9319 1 257 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C2DYK7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9632 1 180
AF-A0A6L7KMT7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9608 1 167
AF-A0A7K0MYK8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9548 1 167
AF-A0A0A9XJ93-F1-model_v4 Epidermal retinol dehydrogenase 2 0.9531 5 186 GO:0005811
GO:0016616
AF-A0A0A9XPN3-F1-model_v4 Epidermal retinol dehydrogenase 2 0.9512 5 188 GO:0005811
GO:0016616

Feature Viewer

pLDDT pTM Quality
92.41 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map