F331478

General Info

Members Datasets Scaffolds Average Seq Length
219 143 438 128

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0041645|Ga0495686_0041645_2008_2433
Length 141
Sequence MQDNHLFEYAIIRVVPRVERVEFLNVGVILYCRPKQFLQTIFTLDTARLFALYPELDIKEVQMHLHAFEQISLGNKEAGPIAALDIASRFRWLTAKRSTVVQTSVVHPGLCKDAAETLARLHKQLVICFTGKIVCTRYKTK

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
136 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
137 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
138 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
139 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
140 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
141 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
142 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
143 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.89
Metatranscriptomes 0
Isolates 4.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.83
Nodule 0
Rhizoplane 1.37
Rhizosphere 90.87
Stem 0
Stem Tuber 0
Unclassified 11.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0041645 3300047472 Bacteria 2923
2 SwRhRL2b_contig_1663468 2162886007 Bacteria 272152
3 SwRhRL2b_contig_714863 2162886007 Bacteria 2466
4 Ga0065714_10237692 3300005288 Unclassified 802
5 Ga0065704_10070133 3300005289 Bacteria 1266035
6 Ga0065704_10245487 3300005289 Bacteria 1003
7 Ga0070658_11329674 3300005327 Bacteria 624
8 Ga0070676_10095026 3300005328 Bacteria 1832
9 Ga0070676_10244269 3300005328 Bacteria 1195
10 Ga0070676_11143414 3300005328 Unclassified 590
11 Ga0070670_100131857 3300005331 Bacteria 2158
12 Ga0070670_100144643 3300005331 Bacteria 2057
13 Ga0070677_10003586 3300005333 Bacteria 5007
14 Ga0070677_10351775 3300005333 Unclassified 763
15 Ga0068869_100047086 3300005334 Bacteria 3112
16 Ga0068869_100368683 3300005334 Bacteria 1174
17 Ga0068869_100606159 3300005334 Bacteria 925
18 Ga0070680_100005724 3300005336 Bacteria 9427
19 Ga0070682_100002203 3300005337 Bacteria 10799
20 Ga0068868_100021921 3300005338 Bacteria 4816
21 Ga0070660_100208198 3300005339 Bacteria 1587
22 Ga0070689_102025232 3300005340 Bacteria 527
23 Ga0070691_10028054 3300005341 Bacteria 2628
24 Ga0070661_101523346 3300005344 Unclassified 564
25 Ga0070668_100032290 3300005347 Bacteria 3984
26 Ga0070668_100079335 3300005347 Bacteria 2570
27 Ga0070668_100834231 3300005347 Bacteria 821
28 Ga0070669_100033364 3300005353 Bacteria 3723
29 Ga0070675_100145559 3300005354 Bacteria 2028
30 Ga0070674_100870988 3300005356 Bacteria 783
31 Ga0070673_100079079 3300005364 Bacteria 2661
32 Ga0070673_100331170 3300005364 Bacteria 1347
33 Ga0070667_100559556 3300005367 Bacteria 1051
34 Ga0070678_100582903 3300005456 Bacteria 997
35 Ga0070681_10007198 3300005458 Bacteria 10846
36 Ga0070681_10020951 3300005458 Bacteria 6550
37 Ga0068867_100208497 3300005459 Bacteria 1568
38 Ga0068867_101071088 3300005459 Bacteria 734
39 Ga0070679_100002062 3300005530 Bacteria 18061
40 Ga0068853_100054546 3300005539 Bacteria 3445
41 Ga0068853_100895744 3300005539 Bacteria 852
42 Ga0070672_100061094 3300005543 Bacteria 2969
43 Ga0070693_100008623 3300005547 Bacteria 5039
44 Ga0070665_100038426 3300005548 Bacteria 4811
45 Ga0068855_100038595 3300005563 Bacteria 5674
46 Ga0068855_100108603 3300005563 Bacteria 3187
47 Ga0068857_100318031 3300005577 Bacteria 1437
48 Ga0068857_100609584 3300005577 Bacteria 1032
49 Ga0068859_100020275 3300005617 Bacteria 6673
50 Ga0068859_100427300 3300005617 Bacteria 1421
51 Ga0068866_10481320 3300005718 Bacteria 818
52 Ga0068866_10629304 3300005718 Bacteria 728
53 Ga0068861_100458427 3300005719 Bacteria 1144
54 Ga0068851_10386967 3300005834 Bacteria 820
55 Ga0068860_100360877 3300005843 Bacteria 1431
56 Ga0068860_100366655 3300005843 Bacteria 1420
57 Ga0068860_100440164 3300005843 Bacteria 1295
58 Ga0068860_102514298 3300005843 Bacteria 534
59 Ga0068862_100482252 3300005844 Bacteria 1174
60 Ga0068862_101268939 3300005844 Unclassified 737
61 Ga0075366_10007850 3300006195 Bacteria 5904
62 Ga0075366_10013093 3300006195 Bacteria 4718
63 Ga0097621_100017896 3300006237 Bacteria 5396
64 Ga0097621_100398034 3300006237 Bacteria 1232
65 Ga0075370_10975707 3300006353 Bacteria 519
66 Ga0068871_100008394 3300006358 Bacteria 7428
67 Ga0068871_100863005 3300006358 Unclassified 837
68 Ga0068865_100210593 3300006881 Bacteria 1514
69 Ga0068865_100544605 3300006881 Unclassified 974
70 Ga0068865_101342893 3300006881 Viruses 637
71 Ga0097620_100020275 3300006931 Bacteria 6673
72 Ga0097620_100427350 3300006931 Bacteria 1421
73 Ga0105240_10001950 3300009093 Bacteria 34159
74 Ga0105240_10658206 3300009093 Bacteria 1147
75 Ga0105243_10000006 3300009148 Bacteria 465541
76 Ga0105243_11287262 3300009148 Unclassified 748
77 Ga0105241_10000834 3300009174 Bacteria 23357
78 Ga0105241_11897379 3300009174 Unclassified 584
79 Ga0105242_10049364 3300009176 Bacteria 3425
80 Ga0105242_10088886 3300009176 Bacteria 2596
81 Ga0105242_10118836 3300009176 Bacteria 2265
82 Ga0105242_10259128 3300009176 Bacteria 1570
83 Ga0105249_10179591 3300009553 Bacteria 2058
84 Ga0105249_10349078 3300009553 Bacteria 1498
85 Ga0105239_10188342 3300010375 Bacteria 2310
86 Ga0105239_11301435 3300010375 Unclassified 838
87 Ga0105246_10209853 3300011119 Bacteria 1519
88 Ga0157371_10266149 3300013102 Unclassified 1236
89 Ga0157371_10449511 3300013102 Bacteria 947
90 Ga0157370_10013699 3300013104 Bacteria 8336
91 Ga0157370_10331626 3300013104 Bacteria 1403
92 Ga0157369_10142290 3300013105 Bacteria 2537
93 Ga0157374_11144175 3300013296 Bacteria 799
94 Ga0157378_10017465 3300013297 Bacteria 6298
95 Ga0157378_10034749 3300013297 Bacteria 4458
96 Ga0157378_10148170 3300013297 Bacteria 2185
97 Ga0163162_10516170 3300013306 Bacteria 1325
98 Ga0163162_12288938 3300013306 Unclassified 621
99 Ga0163162_12540492 3300013306 Bacteria 589
100 Ga0157372_10635048 3300013307 Bacteria 1244
101 Ga0157372_11022200 3300013307 Bacteria 957
102 Ga0157375_10351692 3300013308 Unclassified 1639
103 Ga0157375_11204599 3300013308 Bacteria 888
104 Ga0157375_11396955 3300013308 Bacteria 825
105 Ga0163163_10856675 3300014325 Unclassified 972
106 Ga0157380_12496081 3300014326 Bacteria 583
107 Ga0157379_10456544 3300014968 Bacteria 1180
108 Ga0157379_11493097 3300014968 Bacteria 657
109 Ga0207697_10450494 3300025315 Unclassified 571
110 Ga0207682_10039304 3300025893 Bacteria 1923
111 Ga0207642_10524791 3300025899 Bacteria 728
112 Ga0207688_10089407 3300025901 Bacteria 1767
113 Ga0207680_10114724 3300025903 Bacteria 1753
114 Ga0207645_10003073 3300025907 Bacteria 12814
115 Ga0207645_10404380 3300025907 Bacteria 918
116 Ga0207705_10744343 3300025909 Bacteria 762
117 Ga0207707_10000550 3300025912 Bacteria 38063
118 Ga0207707_10351060 3300025912 Bacteria 1271
119 Ga0207707_10848390 3300025912 Unclassified 758
120 Ga0207695_10002029 3300025913 Bacteria 31090
121 Ga0207660_10012889 3300025917 Bacteria 5475
122 Ga0207652_10001298 3300025921 Bacteria 22214
123 Ga0207681_10025971 3300025923 Bacteria 3774
124 Ga0207650_10573430 3300025925 Bacteria 947
125 Ga0207659_10537278 3300025926 Bacteria 993
126 Ga0207644_10662753 3300025931 Bacteria 869
127 Ga0207706_11018978 3300025933 Bacteria 695
128 Ga0207686_10088060 3300025934 Bacteria 2043
129 Ga0207686_10413044 3300025934 Bacteria 1031
130 Ga0207709_10000007 3300025935 Bacteria 752025
131 Ga0207709_10798885 3300025935 Bacteria 761
132 Ga0207704_10340157 3300025938 Bacteria 1164
133 Ga0207704_11011412 3300025938 Viruses 703
134 Ga0207691_10043729 3300025940 Bacteria 4127
135 Ga0207689_10006919 3300025942 Bacteria 9976
136 Ga0207689_10032329 3300025942 Bacteria 4353
137 Ga0207689_10038427 3300025942 Bacteria 3964
138 Ga0207667_10439389 3300025949 Bacteria 1327
139 Ga0207651_10392290 3300025960 Bacteria 1179
140 Ga0207712_10547311 3300025961 Bacteria 995
141 Ga0207712_11645005 3300025961 Unclassified 575
142 Ga0207668_10089465 3300025972 Unclassified 2257
143 Ga0207668_10408062 3300025972 Bacteria 1150
144 Ga0207668_11567784 3300025972 Unclassified 594
145 Ga0207640_11201238 3300025981 Bacteria 674
146 Ga0207677_10409427 3300026023 Bacteria 1152
147 Ga0207677_11606971 3300026023 Unclassified 602
148 Ga0207703_10332246 3300026035 Bacteria 1395
149 Ga0207639_10013535 3300026041 Bacteria 5713
150 Ga0207639_10047981 3300026041 Bacteria 3230
151 Ga0207639_10400377 3300026041 Bacteria 1236
152 Ga0207648_10015914 3300026089 Bacteria 6894
153 Ga0207648_10081996 3300026089 Bacteria 2813
154 Ga0207648_10521965 3300026089 Bacteria 1088
155 Ga0207676_10821892 3300026095 Bacteria 908
156 Ga0207674_10348143 3300026116 Bacteria 1432
157 Ga0207675_100039130 3300026118 Bacteria 4426
158 Ga0207675_100143802 3300026118 Bacteria 2267
159 Ga0207683_10003482 3300026121 Bacteria 13733
160 Ga0268266_10700046 3300028379 Bacteria 976
161 Ga0268265_10493277 3300028380 Bacteria 1153
162 Ga0268264_10027745 3300028381 Unclassified 4628
163 Ga0268264_10280235 3300028381 Bacteria 1561
164 Ga0268264_10852281 3300028381 Bacteria 913
165 Ga0268264_11535346 3300028381 Bacteria 677
166 Ga0307515_10000001 3300028794 Bacteria 4259510
167 Ga0307515_10246740 3300028794 Bacteria 1546
168 Ga0307414_10008335 3300032004 Bacteria 5871
169 Ga0307414_10139811 3300032004 Bacteria 1894
170 Ga0451793_0029736 3300041452 Bacteria 711
171 Ga0451807_0812048 3300041486 Bacteria 583
172 Ga0451807_2198646 3300041486 Unclassified 894
173 Ga0451833_1067552 3300041491 Bacteria 836
174 Ga0451843_1470429 3300041509 Bacteria 1117
175 Ga0439434_0219651 3300042435 Bacteria 645
176 Ga0451577_0279966 3300042876 Bacteria 1511
177 Ga0451577_0932963 3300042876 Unclassified 781
178 Ga0453683_0079233 3300044673 Bacteria 2057
179 Ga0453684_0639419 3300044712 Bacteria 1162
180 Ga0453684_0643805 3300044712 Bacteria 1157
181 Ga0453684_0860397 3300044712 Bacteria 974
182 Ga0453684_1095496 3300044712 Bacteria 842
183 Ga0495686_0000516 3300047472 Bacteria 55884
184 Ga0495686_0020036 3300047472 Bacteria 4463
185 Ga0496116_0037109 3300048919 Bacteria 3401
186 Ga0496117_0001275 3300048920 Bacteria 37368
187 Ga0496121_0057682 3300048924 Bacteria 3216
188 Ga0496122_0058313 3300048925 Bacteria 2859
189 Ga0496123_0021055 3300048926 Bacteria 5081
190 Ga0496124_0066105 3300048927 Bacteria 3013
191 Ga0496125_0234023 3300048928 Bacteria 1172
192 Ga0496126_0366167 3300048929 Bacteria 1176
193 Ga0501034_0120590 3300049571 Unclassified 2609
194 Ga0501043_0109194 3300049579 Bacteria 2173
195 Ga0501046_0182811 3300049580 Bacteria 1567
196 Ga0501067_0030392 3300049583 Bacteria 2996
197 Ga0501068_0072298 3300049584 Bacteria 2106
198 Ga0501069_0015212 3300049585 Bacteria 4123
199 Ga0501069_0573568 3300049585 Unclassified 676
200 Ga0501070_0149445 3300049586 Bacteria 1927
201 Ga0501071_0553156 3300049587 Unclassified 884
202 Ga0501073_0212587 3300049589 Bacteria 1336
203 Ga0501074_0229227 3300049590 Bacteria 1322
204 Ga0501240_055276 3300049673 Bacteria 689
205 Ga0501080_0186443 3300049742 Bacteria 1907
206 Ga0501269_023928 3300049766 Bacteria 767
207 Ga0501044_0028005 3300049823 Bacteria 5947
208 nmdc:mga0k408_6709_c1 3300050493 Bacteria 6138
209 Ga0501084_0098863 3300054114 Bacteria 2450
210 Ga0501082_0155100 3300060353 Bacteria 1989
211 2722726678 2721755487 Bacteria 6357185
212 2890738313 2890737413 Bacteria 4269751
213 2895500371 2895498888 Bacteria 5283788
214 2896318824 2896317667 Bacteria 4606601
215 2898715943 2898713307 Bacteria 4110805
216 2904782236 2904780799 Bacteria 5840761
217 2919179639 2919177583 Bacteria 5641607
218 3003237139 3003233435 Bacteria 4458031
219 8055588929 8055588893 Bacteria 3619545
220 Ga0495686_0041645
221 SwRhRL2b_contig_1663468
222 SwRhRL2b_contig_714863
223 Ga0065714_10237692
224 Ga0065704_10070133
225 Ga0065704_10245487
226 Ga0070658_11329674
227 Ga0070676_10095026
228 Ga0070676_10244269
229 Ga0070676_11143414
230 Ga0070670_100131857
231 Ga0070670_100144643
232 Ga0070677_10003586
233 Ga0070677_10351775
234 Ga0068869_100047086
235 Ga0068869_100368683
236 Ga0068869_100606159
237 Ga0070680_100005724
238 Ga0070682_100002203
239 Ga0068868_100021921
240 Ga0070660_100208198
241 Ga0070689_102025232
242 Ga0070691_10028054
243 Ga0070661_101523346
244 Ga0070668_100032290
245 Ga0070668_100079335
246 Ga0070668_100834231
247 Ga0070669_100033364
248 Ga0070675_100145559
249 Ga0070674_100870988
250 Ga0070673_100079079
251 Ga0070673_100331170
252 Ga0070667_100559556
253 Ga0070678_100582903
254 Ga0070681_10007198
255 Ga0070681_10020951
256 Ga0068867_100208497
257 Ga0068867_101071088
258 Ga0070679_100002062
259 Ga0068853_100054546
260 Ga0068853_100895744
261 Ga0070672_100061094
262 Ga0070693_100008623
263 Ga0070665_100038426
264 Ga0068855_100038595
265 Ga0068855_100108603
266 Ga0068857_100318031
267 Ga0068857_100609584
268 Ga0068859_100020275
269 Ga0068859_100427300
270 Ga0068866_10481320
271 Ga0068866_10629304
272 Ga0068861_100458427
273 Ga0068851_10386967
274 Ga0068860_100360877
275 Ga0068860_100366655
276 Ga0068860_100440164
277 Ga0068860_102514298
278 Ga0068862_100482252
279 Ga0068862_101268939
280 Ga0075366_10007850
281 Ga0075366_10013093
282 Ga0097621_100017896
283 Ga0097621_100398034
284 Ga0075370_10975707
285 Ga0068871_100008394
286 Ga0068871_100863005
287 Ga0068865_100210593
288 Ga0068865_100544605
289 Ga0068865_101342893
290 Ga0097620_100020275
291 Ga0097620_100427350
292 Ga0105240_10001950
293 Ga0105240_10658206
294 Ga0105243_10000006
295 Ga0105243_11287262
296 Ga0105241_10000834
297 Ga0105241_11897379
298 Ga0105242_10049364
299 Ga0105242_10088886
300 Ga0105242_10118836
301 Ga0105242_10259128
302 Ga0105249_10179591
303 Ga0105249_10349078
304 Ga0105239_10188342
305 Ga0105239_11301435
306 Ga0105246_10209853
307 Ga0157371_10266149
308 Ga0157371_10449511
309 Ga0157370_10013699
310 Ga0157370_10331626
311 Ga0157369_10142290
312 Ga0157374_11144175
313 Ga0157378_10017465
314 Ga0157378_10034749
315 Ga0157378_10148170
316 Ga0163162_10516170
317 Ga0163162_12288938
318 Ga0163162_12540492
319 Ga0157372_10635048
320 Ga0157372_11022200
321 Ga0157375_10351692
322 Ga0157375_11204599
323 Ga0157375_11396955
324 Ga0163163_10856675
325 Ga0157380_12496081
326 Ga0157379_10456544
327 Ga0157379_11493097
328 Ga0207697_10450494
329 Ga0207682_10039304
330 Ga0207642_10524791
331 Ga0207688_10089407
332 Ga0207680_10114724
333 Ga0207645_10003073
334 Ga0207645_10404380
335 Ga0207705_10744343
336 Ga0207707_10000550
337 Ga0207707_10351060
338 Ga0207707_10848390
339 Ga0207695_10002029
340 Ga0207660_10012889
341 Ga0207652_10001298
342 Ga0207681_10025971
343 Ga0207650_10573430
344 Ga0207659_10537278
345 Ga0207644_10662753
346 Ga0207706_11018978
347 Ga0207686_10088060
348 Ga0207686_10413044
349 Ga0207709_10000007
350 Ga0207709_10798885
351 Ga0207704_10340157
352 Ga0207704_11011412
353 Ga0207691_10043729
354 Ga0207689_10006919
355 Ga0207689_10032329
356 Ga0207689_10038427
357 Ga0207667_10439389
358 Ga0207651_10392290
359 Ga0207712_10547311
360 Ga0207712_11645005
361 Ga0207668_10089465
362 Ga0207668_10408062
363 Ga0207668_11567784
364 Ga0207640_11201238
365 Ga0207677_10409427
366 Ga0207677_11606971
367 Ga0207703_10332246
368 Ga0207639_10013535
369 Ga0207639_10047981
370 Ga0207639_10400377
371 Ga0207648_10015914
372 Ga0207648_10081996
373 Ga0207648_10521965
374 Ga0207676_10821892
375 Ga0207674_10348143
376 Ga0207675_100039130
377 Ga0207675_100143802
378 Ga0207683_10003482
379 Ga0268266_10700046
380 Ga0268265_10493277
381 Ga0268264_10027745
382 Ga0268264_10280235
383 Ga0268264_10852281
384 Ga0268264_11535346
385 Ga0307515_10000001
386 Ga0307515_10246740
387 Ga0307414_10008335
388 Ga0307414_10139811
389 Ga0451793_0029736
390 Ga0451807_0812048
391 Ga0451807_2198646
392 Ga0451833_1067552
393 Ga0451843_1470429
394 Ga0439434_0219651
395 Ga0451577_0279966
396 Ga0451577_0932963
397 Ga0453683_0079233
398 Ga0453684_0639419
399 Ga0453684_0643805
400 Ga0453684_0860397
401 Ga0453684_1095496
402 Ga0495686_0000516
403 Ga0495686_0020036
404 Ga0496116_0037109
405 Ga0496117_0001275
406 Ga0496121_0057682
407 Ga0496122_0058313
408 Ga0496123_0021055
409 Ga0496124_0066105
410 Ga0496125_0234023
411 Ga0496126_0366167
412 Ga0501034_0120590
413 Ga0501043_0109194
414 Ga0501046_0182811
415 Ga0501067_0030392
416 Ga0501068_0072298
417 Ga0501069_0015212
418 Ga0501069_0573568
419 Ga0501070_0149445
420 Ga0501071_0553156
421 Ga0501073_0212587
422 Ga0501074_0229227
423 Ga0501240_055276
424 Ga0501080_0186443
425 Ga0501269_023928
426 Ga0501044_0028005
427 nmdc:mga0k408_6709_c1
428 Ga0501084_0098863
429 Ga0501082_0155100
430 2722726678
431 2890738313
432 2895500371
433 2896318824
434 2898715943
435 2904782236
436 2919179639
437 3003237139
438 8055588929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11236

DUF3037

Protein of unknown function (DUF3037)

9

126

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pf6-assembly2.cif.gz_B lutheran glycoprotein, n-terminal domains 1 and 2 0.6551 7 45
5oev-assembly2.cif.gz_B the structure of a glutathione synthetase like-effector (gss22) from globodera pallida in apoform. 0.6089 2 29
6rqm-assembly1.cif.gz_A a blocking anti-ctla-4 nanobody (kn044) complexed with ctla-4 0.5923 2 41
8eoi-assembly1.cif.gz_I structure of a human emc:human cav1.2 channel complex in gdn detergent 0.5865 7 50
5tzn-assembly1.cif.gz_F structure of the viral immunoevasin m12 (smith) bound to the natural killer cell receptor nkr-p1b (b6) 0.5844 5 43
ID Description Score Start End Superfamily
af_H8Y6J1_25_103_2.10.60.10 Mainly Beta;Ribbon;CD59;CD59 0.5788 1 33 2.10.60.10
af_Q9TXX6_1_109_2.100.10.20 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Vitelline membrane outer layer protein I (VOMI) 0.5682 2 46 2.100.10.20
af_Q20096_22_104_2.60.40.1460 Mainly Beta;Sandwich;Immunoglobulin-like;Integrin domains. Chain A, domain 2 0.5611 1 48 2.60.40.1460
af_K7VFB2_357_502_2.100.10.30 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Jacalin-like lectin domain 0.5587 1 43 2.100.10.30
af_Q9XXI3_98_268_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.5523 9 43 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A1Q5ZUB8-F1-model_v4 DUF3037 domain-containing protein 0.9873 19 127
AF-A0A0S9QBQ8-F1-model_v4 DUF3037 domain-containing protein 0.9826 6 127
AF-A0A4Q2XTH9-F1-model_v4 deleted 0.9818 13 127
AF-A0A7W0XUD6-F1-model_v4 Dihydropteroate synthase (EC 2.5.1.15) 0.9808 4 126 GO:0004156
GO:0005829
GO:0009396
AF-A0A7V9SCJ6-F1-model_v4 DUF3037 domain-containing protein 0.9806 2 127

Map