F331468

General Info

Members Datasets Scaffolds Average Seq Length
219 169 438 199

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0000951|Ga0495634_0000951_14322_15068
Length 236
Sequence LTGQSGPVARRNRGIAADPSATIGTSPNKEVPVDTLPPDPSITPPGYPVTFSVDYPDRELDRLTTFFRIFTVIPIAIILELLAKPSFQTGGSGSYYVAAGALVALPAGLMILFRQKYPRWWFDWNLEIMRFANRVGIYLLLMDDTYPSTDEHQSVHLEYPYPDVENDLGRGMPIVKWLLAIPHYFVLFFLGIGAFTGRYPRGIFDYVEGVARWHNRVIGYAFTLVTDRYPPFSLKP

Samples

Sample ID Description Type Environment
1 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
168 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
169 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 0
Rhizoplane 7.31
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 2.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495634_0000951 3300046642 Bacteria 27343
2 JGI24746J21847_1000766 3300001977 Bacteria 4934
3 JGI25407J50210_10045239 3300003373 Bacteria 1122
4 Ga0070683_100060984 3300005329 Bacteria 3506
5 Ga0070682_100000009 3300005337 Bacteria 291635
6 Ga0070682_100021175 3300005337 Bacteria 3832
7 Ga0068868_100055076 3300005338 Bacteria 3137
8 Ga0070660_100002213 3300005339 Bacteria 13399
9 Ga0070689_100204948 3300005340 Bacteria 1612
10 Ga0070691_10282494 3300005341 Bacteria 901
11 Ga0070661_100057765 3300005344 Bacteria 2843
12 Ga0070692_10006000 3300005345 Bacteria 5235
13 Ga0070668_100020143 3300005347 Bacteria 5030
14 Ga0070675_100001902 3300005354 Bacteria 15408
15 Ga0070674_100087608 3300005356 Bacteria 2239
16 Ga0070673_100063579 3300005364 Bacteria 2937
17 Ga0070659_100008279 3300005366 Bacteria 7591
18 Ga0070709_10449187 3300005434 Bacteria 971
19 Ga0070714_100005788 3300005435 Bacteria 9480
20 Ga0070714_100052165 3300005435 Bacteria 3488
21 Ga0070713_100073272 3300005436 Bacteria 2898
22 Ga0070708_100204676 3300005445 Bacteria 1848
23 Ga0070708_100236724 3300005445 Bacteria 1714
24 Ga0070663_100004202 3300005455 Bacteria 8421
25 Ga0070662_100161154 3300005457 Bacteria 1755
26 Ga0070706_100005228 3300005467 Bacteria 12378
27 Ga0070706_100192476 3300005467 Bacteria 1905
28 Ga0070706_100210887 3300005467 Bacteria 1814
29 Ga0070707_100347535 3300005468 Bacteria 1441
30 Ga0070707_100620906 3300005468 Bacteria 1043
31 Ga0070698_100069370 3300005471 Bacteria 3539
32 Ga0070698_100201719 3300005471 Bacteria 1925
33 Ga0070698_100437983 3300005471 Unclassified 1242
34 Ga0070699_100508377 3300005518 Bacteria 1095
35 Ga0070684_100131324 3300005535 Bacteria 2259
36 Ga0070684_100139285 3300005535 Bacteria 2193
37 Ga0070697_100170207 3300005536 Unclassified 1843
38 Ga0068853_100001933 3300005539 Bacteria 15274
39 Ga0070672_100004049 3300005543 Bacteria 9566
40 Ga0070695_100711581 3300005545 Bacteria 798
41 Ga0070696_100379611 3300005546 Bacteria 1101
42 Ga0070693_100002829 3300005547 Bacteria 7989
43 Ga0068855_100940448 3300005563 Bacteria 911
44 Ga0070664_100181715 3300005564 Bacteria 1869
45 Ga0068852_100021773 3300005616 Bacteria 5127
46 Ga0068859_100262062 3300005617 Bacteria 1820
47 Ga0068864_100000023 3300005618 Bacteria 257064
48 Ga0068851_10035419 3300005834 Bacteria 2495
49 Ga0068858_100000545 3300005842 Bacteria 39201
50 Ga0068860_100326818 3300005843 Bacteria 1506
51 Ga0081455_10153896 3300005937 Bacteria 1770
52 Ga0081538_10032774 3300005981 Bacteria 3473
53 Ga0081540_1001081 3300005983 Bacteria 24216
54 Ga0081540_1073385 3300005983 Bacteria 1572
55 Ga0070717_10000056 3300006028 Bacteria 96306
56 Ga0070717_10022848 3300006028 Bacteria 4948
57 Ga0070717_10299670 3300006028 Bacteria 1429
58 Ga0075365_10042017 3300006038 Bacteria 2988
59 Ga0075365_10114082 3300006038 Bacteria 1859
60 Ga0075365_10180222 3300006038 Bacteria 1477
61 Ga0075363_100004315 3300006048 Bacteria 6190
62 Ga0075363_100590564 3300006048 Bacteria 665
63 Ga0070716_100363381 3300006173 Bacteria 1029
64 Ga0075362_10245252 3300006177 Bacteria 880
65 Ga0068871_100242355 3300006358 Bacteria 1568
66 Ga0075428_100420426 3300006844 Bacteria 1432
67 Ga0075433_10050003 3300006852 Bacteria 3638
68 Ga0075433_10056130 3300006852 Bacteria 3440
69 Ga0075429_100086457 3300006880 Bacteria 2733
70 Ga0068865_100011866 3300006881 Bacteria 5467
71 Ga0097620_100262042 3300006931 Bacteria 1820
72 Ga0075435_100074352 3300007076 Bacteria 2779
73 Ga0111539_11144009 3300009094 Bacteria 904
74 Ga0114129_10266819 3300009147 Bacteria 2292
75 Ga0105243_10090123 3300009148 Bacteria 2523
76 Ga0105242_10380906 3300009176 Bacteria 1311
77 Ga0105238_10272297 3300009551 Bacteria 1674
78 Ga0105249_10253227 3300009553 Bacteria 1746
79 Ga0105246_10219421 3300011119 Bacteria 1490
80 Ga0157371_10151252 3300013102 Bacteria 1655
81 Ga0157370_10002517 3300013104 Bacteria 22034
82 Ga0157374_10026299 3300013296 Bacteria 5235
83 Ga0157372_10719766 3300013307 Bacteria 1161
84 Ga0157375_10002471 3300013308 Bacteria 15996
85 Ga0157375_10025660 3300013308 Bacteria 5481
86 Ga0157375_10419956 3300013308 Bacteria 1503
87 Ga0163163_10176625 3300014325 Bacteria 2182
88 Ga0157380_10000192 3300014326 Bacteria 35608
89 Ga0157380_10252588 3300014326 Bacteria 1597
90 Ga0157380_10591372 3300014326 Bacteria 1096
91 Ga0157379_10745364 3300014968 Bacteria 922
92 Ga0163161_10000103 3300017792 Bacteria 81496
93 Ga0213874_10000878 3300021377 Bacteria 6141
94 Ga0213876_10216956 3300021384 Bacteria 1017
95 Ga0207697_10174250 3300025315 Bacteria 941
96 Ga0207684_10029695 3300025910 Bacteria 4654
97 Ga0207684_10162879 3300025910 Bacteria 1921
98 Ga0207693_10158850 3300025915 Bacteria 1778
99 Ga0207657_10001009 3300025919 Bacteria 29964
100 Ga0207646_10055259 3300025922 Bacteria 3550
101 Ga0207646_10101807 3300025922 Bacteria 2575
102 Ga0207646_10274787 3300025922 Bacteria 1523
103 Ga0207646_10622482 3300025922 Bacteria 968
104 Ga0207700_10046697 3300025928 Bacteria 3204
105 Ga0207664_10002070 3300025929 Bacteria 13205
106 Ga0207664_10070358 3300025929 Bacteria 2815
107 Ga0207690_10013107 3300025932 Bacteria 4973
108 Ga0207706_10179333 3300025933 Bacteria 1860
109 Ga0207686_10262085 3300025934 Bacteria 1268
110 Ga0207670_10175035 3300025936 Bacteria 1612
111 Ga0207669_10092441 3300025937 Bacteria 1974
112 Ga0207691_10021660 3300025940 Bacteria 6067
113 Ga0207661_10497836 3300025944 Bacteria 1113
114 Ga0207661_10661408 3300025944 Bacteria 960
115 Ga0207712_10013495 3300025961 Bacteria 5239
116 Ga0207658_10130873 3300025986 Bacteria 2016
117 Ga0207677_10321299 3300026023 Bacteria 1286
118 Ga0207703_10000547 3300026035 Bacteria 38608
119 Ga0207639_10002383 3300026041 Bacteria 12613
120 Ga0207678_10005776 3300026067 Bacteria 11030
121 Ga0207702_10026336 3300026078 Bacteria 4828
122 Ga0207648_10046478 3300026089 Bacteria 3806
123 Ga0207676_10000025 3300026095 Bacteria 261714
124 Ga0207675_100499312 3300026118 Bacteria 1211
125 Ga0207698_10307722 3300026142 Bacteria 1478
126 Ga0307408_100364865 3300031548 Bacteria 1230
127 Ga0307408_100733507 3300031548 Bacteria 891
128 Ga0316576_10067078 3300031727 Unclassified 2641
129 Ga0316577_10201533 3300031733 Bacteria 1125
130 Ga0307406_10158209 3300031901 Bacteria 1625
131 Ga0307409_100032309 3300031995 Bacteria 3793
132 Ga0307414_10336656 3300032004 Bacteria 1290
133 Ga0307411_10442520 3300032005 Bacteria 1085
134 Ga0316574_0024435 3300035398 Bacteria 3616
135 Ga0373937_0006219 3300036401 Bacteria 10291
136 Ga0373937_0032638 3300036401 Bacteria 4723
137 Ga0316582_0817023 3300036647 Bacteria 639
138 Ga0316584_0088249 3300036712 Bacteria 2322
139 Ga0395899_0332633 3300037312 Bacteria 1020
140 Ga0395900_0145638 3300037418 Bacteria 2422
141 Ga0395900_0161759 3300037418 Bacteria 2283
142 Ga0395898_0051088 3300037466 Bacteria 4044
143 Ga0395901_0265099 3300038443 Bacteria 1787
144 Ga0395901_0555536 3300038443 Bacteria 1163
145 Ga0395901_0645458 3300038443 Bacteria 1062
146 Ga0400489_87436 3300039093 Unclassified 2512
147 Ga0436365_0537023 3300039437 Bacteria 4629
148 Ga0436363_0046650 3300039450 Bacteria 33316
149 Ga0436362_1026281 3300039453 Bacteria 1949
150 Ga0439446_0053423 3300042156 Bacteria 1210
151 Ga0439434_0033987 3300042435 Bacteria 1556
152 Ga0466967_1016679 3300045976 Bacteria 825
153 Ga0495651_0258276 3300046462 Bacteria 1186
154 Ga0495653_0008533 3300046463 Bacteria 8404
155 Ga0495653_0044792 3300046463 Bacteria 3433
156 Ga0495582_0000002 3300046473 Bacteria 219909
157 Ga0495662_0000352 3300046476 Bacteria 20173
158 Ga0495608_0007119 3300046511 Bacteria 7913
159 Ga0495618_0243640 3300046514 Bacteria 1129
160 Ga0495644_0005764 3300046523 Bacteria 4837
161 Ga0495586_0000363 3300046535 Bacteria 28122
162 Ga0495621_0023969 3300046539 Bacteria 2033
163 Ga0495667_0069829 3300046559 Bacteria 2292
164 Ga0495667_0391636 3300046559 Bacteria 876
165 Ga0495656_0000290 3300046615 Bacteria 17454
166 Ga0495634_0000021 3300046642 Bacteria 120521
167 Ga0495634_0016894 3300046642 Bacteria 5213
168 Ga0495635_0013966 3300046663 Bacteria 5620
169 Ga0495646_0144802 3300046680 Bacteria 1326
170 Ga0495647_0000002 3300046681 Bacteria 174959
171 Ga0495658_0000001 3300046683 Bacteria 385362
172 Ga0495669_0141403 3300046684 Bacteria 1136
173 Ga0495600_0027309 3300046809 Bacteria 3688
174 Ga0495600_0088157 3300046809 Bacteria 2024
175 Ga0495672_0017718 3300047320 Bacteria 4754
176 Ga0495676_0403548 3300047321 Bacteria 907
177 Ga0495680_0001091 3300047322 Bacteria 30089
178 Ga0495680_0186383 3300047322 Unclassified 1495
179 Ga0495593_0049084 3300047673 Bacteria 2241
180 Ga0496102_0842246 3300048905 Bacteria 839
181 Ga0496106_0000107 3300048909 Bacteria 64689
182 Ga0496107_0044417 3300048910 Bacteria 3194
183 Ga0496107_0699576 3300048910 Bacteria 745
184 Ga0496108_0000133 3300048911 Bacteria 72253
185 Ga0496108_0034202 3300048911 Bacteria 4222
186 Ga0496108_0288062 3300048911 Bacteria 1430
187 Ga0496109_0000021 3300048912 Bacteria 189945
188 Ga0496110_0050020 3300048913 Bacteria 3669
189 Ga0496111_0018056 3300048914 Bacteria 4880
190 Ga0496111_0177547 3300048914 Bacteria 1583
191 Ga0496113_0021549 3300048916 Bacteria 4547
192 Ga0496113_0075681 3300048916 Bacteria 2570
193 Ga0496113_0146508 3300048916 Bacteria 1860
194 Ga0496113_0183023 3300048916 Bacteria 1661
195 Ga0496114_0504780 3300048917 Bacteria 1070
196 Ga0501042_0010860 3300049578 Bacteria 6126
197 nmdc:mga03683_34460_c2 3300050489 Bacteria 1394
198 nmdc:mga03n38_60665_c1 3300050490 Bacteria 1720
199 nmdc:mga05p37_210747_c1 3300050507 Bacteria 2349
200 nmdc:mga09592_110755_c1 3300050508 Bacteria 2355
201 nmdc:mga0qj67_411729_c1 3300050509 Bacteria 1090
202 nmdc:mga08y16_71652_c1 3300050511 Bacteria 3611
203 nmdc:mga0n895_142565_c1 3300050512 Bacteria 2425
204 nmdc:mga0n895_348305_c1 3300050512 Bacteria 1500
205 nmdc:mga0rr50_152073_c1 3300050513 Bacteria 1871
206 nmdc:mga08x19_319187_c1 3300050514 Bacteria 1081
207 nmdc:mga0a205_125_c2 3300050515 Bacteria 7254
208 nmdc:mga0a205_7961_c1 3300050515 Bacteria 9626
209 Ga0495601_0211401 3300053077 Bacteria 1267
210 Ga0495612_0005775 3300053078 Bacteria 5110
211 Ga0495595_0000661 3300053084 Bacteria 13132
212 Ga0495619_0000032 3300053085 Bacteria 139067
213 Ga0495619_0000347 3300053085 Bacteria 32351
214 Ga0495619_0004222 3300053085 Bacteria 9167
215 Ga0495619_0042576 3300053085 Bacteria 2974
216 Ga0495619_0061086 3300053085 Bacteria 2507
217 Ga0500566_0000140 3300053094 Bacteria 37236
218 Ga0500637_0018534 3300053178 Bacteria 3742
219 Ga0590071_003079 3300059421 Bacteria 4133
220 Ga0495634_0000951
221 JGI24746J21847_1000766
222 JGI25407J50210_10045239
223 Ga0070683_100060984
224 Ga0070682_100000009
225 Ga0070682_100021175
226 Ga0068868_100055076
227 Ga0070660_100002213
228 Ga0070689_100204948
229 Ga0070691_10282494
230 Ga0070661_100057765
231 Ga0070692_10006000
232 Ga0070668_100020143
233 Ga0070675_100001902
234 Ga0070674_100087608
235 Ga0070673_100063579
236 Ga0070659_100008279
237 Ga0070709_10449187
238 Ga0070714_100005788
239 Ga0070714_100052165
240 Ga0070713_100073272
241 Ga0070708_100204676
242 Ga0070708_100236724
243 Ga0070663_100004202
244 Ga0070662_100161154
245 Ga0070706_100005228
246 Ga0070706_100192476
247 Ga0070706_100210887
248 Ga0070707_100347535
249 Ga0070707_100620906
250 Ga0070698_100069370
251 Ga0070698_100201719
252 Ga0070698_100437983
253 Ga0070699_100508377
254 Ga0070684_100131324
255 Ga0070684_100139285
256 Ga0070697_100170207
257 Ga0068853_100001933
258 Ga0070672_100004049
259 Ga0070695_100711581
260 Ga0070696_100379611
261 Ga0070693_100002829
262 Ga0068855_100940448
263 Ga0070664_100181715
264 Ga0068852_100021773
265 Ga0068859_100262062
266 Ga0068864_100000023
267 Ga0068851_10035419
268 Ga0068858_100000545
269 Ga0068860_100326818
270 Ga0081455_10153896
271 Ga0081538_10032774
272 Ga0081540_1001081
273 Ga0081540_1073385
274 Ga0070717_10000056
275 Ga0070717_10022848
276 Ga0070717_10299670
277 Ga0075365_10042017
278 Ga0075365_10114082
279 Ga0075365_10180222
280 Ga0075363_100004315
281 Ga0075363_100590564
282 Ga0070716_100363381
283 Ga0075362_10245252
284 Ga0068871_100242355
285 Ga0075428_100420426
286 Ga0075433_10050003
287 Ga0075433_10056130
288 Ga0075429_100086457
289 Ga0068865_100011866
290 Ga0097620_100262042
291 Ga0075435_100074352
292 Ga0111539_11144009
293 Ga0114129_10266819
294 Ga0105243_10090123
295 Ga0105242_10380906
296 Ga0105238_10272297
297 Ga0105249_10253227
298 Ga0105246_10219421
299 Ga0157371_10151252
300 Ga0157370_10002517
301 Ga0157374_10026299
302 Ga0157372_10719766
303 Ga0157375_10002471
304 Ga0157375_10025660
305 Ga0157375_10419956
306 Ga0163163_10176625
307 Ga0157380_10000192
308 Ga0157380_10252588
309 Ga0157380_10591372
310 Ga0157379_10745364
311 Ga0163161_10000103
312 Ga0213874_10000878
313 Ga0213876_10216956
314 Ga0207697_10174250
315 Ga0207684_10029695
316 Ga0207684_10162879
317 Ga0207693_10158850
318 Ga0207657_10001009
319 Ga0207646_10055259
320 Ga0207646_10101807
321 Ga0207646_10274787
322 Ga0207646_10622482
323 Ga0207700_10046697
324 Ga0207664_10002070
325 Ga0207664_10070358
326 Ga0207690_10013107
327 Ga0207706_10179333
328 Ga0207686_10262085
329 Ga0207670_10175035
330 Ga0207669_10092441
331 Ga0207691_10021660
332 Ga0207661_10497836
333 Ga0207661_10661408
334 Ga0207712_10013495
335 Ga0207658_10130873
336 Ga0207677_10321299
337 Ga0207703_10000547
338 Ga0207639_10002383
339 Ga0207678_10005776
340 Ga0207702_10026336
341 Ga0207648_10046478
342 Ga0207676_10000025
343 Ga0207675_100499312
344 Ga0207698_10307722
345 Ga0307408_100364865
346 Ga0307408_100733507
347 Ga0316576_10067078
348 Ga0316577_10201533
349 Ga0307406_10158209
350 Ga0307409_100032309
351 Ga0307414_10336656
352 Ga0307411_10442520
353 Ga0316574_0024435
354 Ga0373937_0006219
355 Ga0373937_0032638
356 Ga0316582_0817023
357 Ga0316584_0088249
358 Ga0395899_0332633
359 Ga0395900_0145638
360 Ga0395900_0161759
361 Ga0395898_0051088
362 Ga0395901_0265099
363 Ga0395901_0555536
364 Ga0395901_0645458
365 Ga0400489_87436
366 Ga0436365_0537023
367 Ga0436363_0046650
368 Ga0436362_1026281
369 Ga0439446_0053423
370 Ga0439434_0033987
371 Ga0466967_1016679
372 Ga0495651_0258276
373 Ga0495653_0008533
374 Ga0495653_0044792
375 Ga0495582_0000002
376 Ga0495662_0000352
377 Ga0495608_0007119
378 Ga0495618_0243640
379 Ga0495644_0005764
380 Ga0495586_0000363
381 Ga0495621_0023969
382 Ga0495667_0069829
383 Ga0495667_0391636
384 Ga0495656_0000290
385 Ga0495634_0000021
386 Ga0495634_0016894
387 Ga0495635_0013966
388 Ga0495646_0144802
389 Ga0495647_0000002
390 Ga0495658_0000001
391 Ga0495669_0141403
392 Ga0495600_0027309
393 Ga0495600_0088157
394 Ga0495672_0017718
395 Ga0495676_0403548
396 Ga0495680_0001091
397 Ga0495680_0186383
398 Ga0495593_0049084
399 Ga0496102_0842246
400 Ga0496106_0000107
401 Ga0496107_0044417
402 Ga0496107_0699576
403 Ga0496108_0000133
404 Ga0496108_0034202
405 Ga0496108_0288062
406 Ga0496109_0000021
407 Ga0496110_0050020
408 Ga0496111_0018056
409 Ga0496111_0177547
410 Ga0496113_0021549
411 Ga0496113_0075681
412 Ga0496113_0146508
413 Ga0496113_0183023
414 Ga0496114_0504780
415 Ga0501042_0010860
416 nmdc:mga03683_34460_c2
417 nmdc:mga03n38_60665_c1
418 nmdc:mga05p37_210747_c1
419 nmdc:mga09592_110755_c1
420 nmdc:mga0qj67_411729_c1
421 nmdc:mga08y16_71652_c1
422 nmdc:mga0n895_142565_c1
423 nmdc:mga0n895_348305_c1
424 nmdc:mga0rr50_152073_c1
425 nmdc:mga08x19_319187_c1
426 nmdc:mga0a205_125_c2
427 nmdc:mga0a205_7961_c1
428 Ga0495601_0211401
429 Ga0495612_0005775
430 Ga0495595_0000661
431 Ga0495619_0000032
432 Ga0495619_0000347
433 Ga0495619_0004222
434 Ga0495619_0042576
435 Ga0495619_0061086
436 Ga0500566_0000140
437 Ga0500637_0018534
438 Ga0590071_003079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map