F331382

General Info

Members Datasets Scaffolds Average Seq Length
219 143 438 266

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0132908|Ga0466972_0132908_145_1125
Length 326
Sequence MASSVAAEAVDRLDARRRRLTGTWSLMTEHWQIAEGASVDLSEIDPHTCEAAPGGKRETRAASDRLRRELRDLQKRLYAEDSRAVLVVLQAMDAGGKDGAIRKAFSGLNPQGCRVHTFNKPTEEELAHDFLWRIHPRCPRKGTIGIFNRSHYEEVLVVRVHQENLDRQRLPGTSAGKNMWARRFREINDWERYLTDNGFAVVKLFLNLSWEEQRARFLKRIDVPDRNWKFSAADIRERRFWKDYQHAFSEMLSATSKPWAPWHVIPADRKWFARLCVGAVLAHTLIELDPQYPRVSAEARDELRKARAELEAEEKPPTAAGGSRRA

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
91 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
143 2558860280 Kutzneria sp. 744 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.65
Rhizosphere 94.52
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0132908 3300044658 Bacteria 1172
2 JGI25406J46586_10008226 3300003203 Bacteria 4733
3 Ga0070658_10091632 3300005327 Bacteria 2505
4 Ga0070683_100009679 3300005329 Bacteria 8250
5 Ga0070683_100017145 3300005329 Bacteria 6396
6 Ga0070682_100313431 3300005337 Bacteria 1156
7 Ga0070660_100060618 3300005339 Bacteria 2937
8 Ga0070661_100020163 3300005344 Bacteria 4753
9 Ga0070692_10060200 3300005345 Bacteria 1998
10 Ga0070671_100043151 3300005355 Bacteria 3749
11 Ga0070673_100187187 3300005364 Bacteria 1776
12 Ga0070659_100085061 3300005366 Bacteria 2530
13 Ga0070708_100064629 3300005445 Bacteria 3279
14 Ga0070681_10002997 3300005458 Bacteria 15669
15 Ga0070681_10049991 3300005458 Bacteria 4173
16 Ga0070685_10048877 3300005466 Bacteria 2438
17 Ga0070706_100091793 3300005467 Bacteria 2817
18 Ga0070706_100549766 3300005467 Unclassified 1074
19 Ga0070707_100333030 3300005468 Bacteria 1475
20 Ga0070698_100020569 3300005471 Bacteria 6920
21 Ga0070698_100031264 3300005471 Bacteria 5520
22 Ga0070698_100031640 3300005471 Bacteria 5484
23 Ga0070698_100679941 3300005471 Bacteria 971
24 Ga0070699_100012069 3300005518 Bacteria 7455
25 Ga0070699_100192520 3300005518 Bacteria 1812
26 Ga0070684_100018623 3300005535 Bacteria 5725
27 Ga0070684_100080824 3300005535 Bacteria 2876
28 Ga0068853_100164547 3300005539 Bacteria 2004
29 Ga0070672_100078262 3300005543 Bacteria 2645
30 Ga0070704_100008098 3300005549 Bacteria 6281
31 Ga0070664_100064427 3300005564 Bacteria 3126
32 Ga0068854_100272424 3300005578 Bacteria 1360
33 Ga0068856_100148541 3300005614 Bacteria 2352
34 Ga0068856_100183356 3300005614 Bacteria 2107
35 Ga0068861_100703097 3300005719 Unclassified 939
36 Ga0068870_10077418 3300005840 Bacteria 1830
37 Ga0068870_10158719 3300005840 Bacteria 1339
38 Ga0081539_10000288 3300005985 Bacteria 113905
39 Ga0068871_100228728 3300006358 Bacteria 1614
40 Ga0075428_100351078 3300006844 Bacteria 1583
41 Ga0075430_100241167 3300006846 Bacteria 1498
42 Ga0075431_100000945 3300006847 Bacteria 25631
43 Ga0075431_100438046 3300006847 Bacteria 1304
44 Ga0075433_10311913 3300006852 Bacteria 1392
45 Ga0075434_100006888 3300006871 Bacteria 10468
46 Ga0075429_100030191 3300006880 Bacteria 4709
47 Ga0068865_100186494 3300006881 Bacteria 1601
48 Ga0075435_100025330 3300007076 Bacteria 4618
49 Ga0111539_10054651 3300009094 Bacteria 4750
50 Ga0111539_10125668 3300009094 Bacteria 3005
51 Ga0111539_10440256 3300009094 Bacteria 1518
52 Ga0105245_10176400 3300009098 Bacteria 2039
53 Ga0105245_10184503 3300009098 Bacteria 1995
54 Ga0114129_10009127 3300009147 Bacteria 14136
55 Ga0114129_10048838 3300009147 Bacteria 5948
56 Ga0114129_10053136 3300009147 Bacteria 5682
57 Ga0114129_10424196 3300009147 Bacteria 1749
58 Ga0105243_10006249 3300009148 Bacteria 9204
59 Ga0105243_10475816 3300009148 Bacteria 1178
60 Ga0105241_10119260 3300009174 Bacteria 2122
61 Ga0105248_10307858 3300009177 Bacteria 1784
62 Ga0105238_10388112 3300009551 Bacteria 1388
63 Ga0105249_10614563 3300009553 Unclassified 1142
64 Ga0105239_10060251 3300010375 Bacteria 4166
65 Ga0105239_10181171 3300010375 Bacteria 2357
66 Ga0105246_10029587 3300011119 Bacteria 3608
67 Ga0157369_10007590 3300013105 Bacteria 12481
68 Ga0157372_10008513 3300013307 Bacteria 10891
69 Ga0157372_10143592 3300013307 Bacteria 2752
70 Ga0157375_10123284 3300013308 Bacteria 2704
71 Ga0157380_10051542 3300014326 Bacteria 3255
72 Ga0157377_10129673 3300014745 Bacteria 1538
73 Ga0157379_10419491 3300014968 Bacteria 1232
74 Ga0207643_10061536 3300025908 Bacteria 2144
75 Ga0207705_10071576 3300025909 Bacteria 2514
76 Ga0207707_10050103 3300025912 Bacteria 3638
77 Ga0207707_10126113 3300025912 Bacteria 2238
78 Ga0207660_10016260 3300025917 Bacteria 4923
79 Ga0207657_10161849 3300025919 Bacteria 1817
80 Ga0207649_10051920 3300025920 Bacteria 2541
81 Ga0207652_10118733 3300025921 Bacteria 2351
82 Ga0207646_10096305 3300025922 Bacteria 2651
83 Ga0207694_10153378 3300025924 Bacteria 1857
84 Ga0207690_10276460 3300025932 Bacteria 1307
85 Ga0207686_10074999 3300025934 Bacteria 2188
86 Ga0207709_10045908 3300025935 Bacteria 2648
87 Ga0207691_10038678 3300025940 Bacteria 4415
88 Ga0207661_10009019 3300025944 Bacteria 7146
89 Ga0207661_10099720 3300025944 Bacteria 2436
90 Ga0207679_10100818 3300025945 Bacteria 2257
91 Ga0207640_10046517 3300025981 Bacteria 2792
92 Ga0207639_10232523 3300026041 Bacteria 1598
93 Ga0207708_10125009 3300026075 Bacteria 2007
94 Ga0207708_10177697 3300026075 Bacteria 1689
95 Ga0207702_10120688 3300026078 Bacteria 2346
96 Ga0207674_10036714 3300026116 Bacteria 5101
97 Ga0307408_100608393 3300031548 Bacteria 972
98 Ga0307405_10043950 3300031731 Bacteria 2730
99 Ga0307405_10060239 3300031731 Bacteria 2395
100 Ga0316577_10067150 3300031733 Bacteria 2002
101 Ga0307413_10012878 3300031824 Bacteria 4180
102 Ga0307413_10066407 3300031824 Bacteria 2251
103 Ga0307413_10071639 3300031824 Bacteria 2185
104 Ga0307410_10316608 3300031852 Bacteria 1236
105 Ga0307407_10092092 3300031903 Bacteria 1861
106 Ga0307407_10139698 3300031903 Bacteria 1561
107 Ga0307409_100049477 3300031995 Bacteria 3205
108 Ga0307409_100147258 3300031995 Bacteria 2038
109 Ga0307409_100189737 3300031995 Bacteria 1828
110 Ga0307416_100078367 3300032002 Bacteria 2780
111 Ga0307416_100126895 3300032002 Bacteria 2287
112 Ga0307416_100140481 3300032002 Bacteria 2194
113 Ga0307414_10156700 3300032004 Bacteria 1804
114 Ga0307414_10246943 3300032004 Bacteria 1481
115 Ga0307414_10335381 3300032004 Bacteria 1292
116 Ga0307411_10088807 3300032005 Bacteria 2151
117 Ga0307411_10547650 3300032005 Bacteria 986
118 Ga0307415_100150234 3300032126 Bacteria 1792
119 Ga0373935_0045935 3300035692 Bacteria 2757
120 Ga0373927_0004307 3300035695 Bacteria 9988
121 Ga0316582_0094976 3300036647 Bacteria 1967
122 Ga0316582_0428700 3300036647 Bacteria 911
123 Ga0316584_0053308 3300036712 Bacteria 3027
124 Ga0373925_0000325 3300037068 Bacteria 49853
125 Ga0316581_0100002 3300037588 Bacteria 893
126 Ga0400489_03561 3300039093 Bacteria 3327
127 Ga0436365_1442746 3300039437 Bacteria 5299
128 Ga0436360_0257603 3300039438 Bacteria 1182
129 Ga0436362_0134411 3300039453 Bacteria 6279
130 Ga0451853_1675534 3300041512 Bacteria 2170
131 Ga0439446_0017025 3300042156 Bacteria 2029
132 Ga0439446_0095684 3300042156 Bacteria 934
133 Ga0453683_0001432 3300044673 Bacteria 20752
134 Ga0453683_0031704 3300044673 Bacteria 3338
135 Ga0453683_0053927 3300044673 Bacteria 2516
136 Ga0466968_0054497 3300044735 Bacteria 1714
137 Ga0466960_0249433 3300044901 Bacteria 985
138 Ga0451576_0004218 3300045051 Bacteria 18885
139 Ga0466958_0031688 3300045836 Bacteria 3143
140 Ga0496104_0151249 3300048907 Bacteria 2228
141 Ga0496104_0202878 3300048907 Bacteria 1895
142 Ga0496105_0149522 3300048908 Bacteria 1920
143 Ga0496105_0520243 3300048908 Bacteria 932
144 Ga0496108_0332437 3300048911 Bacteria 1325
145 Ga0496109_0001867 3300048912 Bacteria 17461
146 Ga0496110_0012412 3300048913 Bacteria 7004
147 Ga0496111_0001818 3300048914 Bacteria 12540
148 Ga0501031_0233220 3300049568 Bacteria 1197
149 Ga0501033_0087519 3300049570 Bacteria 2280
150 Ga0501034_0001501 3300049571 Bacteria 30647
151 Ga0501034_0007612 3300049571 Bacteria 11524
152 Ga0501034_0016884 3300049571 Bacteria 7486
153 Ga0501034_0079660 3300049571 Bacteria 3279
154 Ga0501036_0133822 3300049572 Bacteria 2092
155 Ga0501036_0351427 3300049572 Bacteria 1231
156 Ga0501037_0232762 3300049573 Bacteria 1293
157 Ga0501039_0090317 3300049575 Bacteria 2387
158 Ga0501039_0364642 3300049575 Bacteria 1135
159 Ga0501039_0396973 3300049575 Bacteria 1083
160 Ga0501040_0137069 3300049576 Bacteria 1723
161 Ga0501040_0371412 3300049576 Bacteria 1026
162 Ga0501041_0094474 3300049577 Bacteria 1847
163 Ga0501042_0094612 3300049578 Bacteria 2146
164 Ga0501042_0100285 3300049578 Bacteria 2082
165 Ga0501046_0239199 3300049580 Bacteria 1339
166 Ga0501048_0083921 3300049582 Bacteria 2246
167 Ga0501048_0426504 3300049582 Bacteria 949
168 Ga0501067_0016793 3300049583 Bacteria 4044
169 Ga0501068_0236630 3300049584 Bacteria 1162
170 Ga0501069_0046082 3300049585 Bacteria 2417
171 Ga0501069_0080333 3300049585 Bacteria 1836
172 Ga0501071_0027145 3300049587 Bacteria 4026
173 Ga0501071_0040676 3300049587 Bacteria 3327
174 Ga0501071_0140985 3300049587 Bacteria 1795
175 Ga0501072_0021888 3300049588 Bacteria 4959
176 Ga0501072_0127242 3300049588 Bacteria 2030
177 Ga0501072_0204293 3300049588 Bacteria 1575
178 Ga0501075_0005659 3300049591 Bacteria 8553
179 Ga0501076_0023529 3300049592 Bacteria 4750
180 Ga0501076_0056732 3300049592 Bacteria 3109
181 Ga0501076_0088428 3300049592 Bacteria 2490
182 Ga0501076_0113964 3300049592 Bacteria 2187
183 Ga0501077_0024331 3300049593 Bacteria 3844
184 Ga0501077_0032315 3300049593 Bacteria 3331
185 Ga0501077_0039325 3300049593 Bacteria 3013
186 Ga0501077_0147967 3300049593 Bacteria 1490
187 Ga0501079_0009233 3300049741 Bacteria 7470
188 Ga0501079_0066325 3300049741 Bacteria 2785
189 Ga0501079_0269148 3300049741 Bacteria 1332
190 Ga0501080_0139305 3300049742 Bacteria 2244
191 Ga0501080_0210778 3300049742 Bacteria 1780
192 Ga0501081_0055748 3300049743 Bacteria 2731
193 Ga0501081_0145518 3300049743 Bacteria 1700
194 Ga0501045_0034608 3300049824 Bacteria 3667
195 Ga0501045_0081435 3300049824 Bacteria 2387
196 Ga0501045_0110121 3300049824 Bacteria 2042
197 Ga0501045_0196981 3300049824 Bacteria 1501
198 nmdc:mga05p37_117648_c1 3300050507 Bacteria 3266
199 nmdc:mga09592_27104_c1 3300050508 Bacteria 4753
200 nmdc:mga0qj67_140581_c1 3300050509 Bacteria 1957
201 nmdc:mga06r32_1190_c1 3300050510 Bacteria 23404
202 nmdc:mga08y16_43697_c1 3300050511 Bacteria 4696
203 nmdc:mga0n895_330819_c1 3300050512 Bacteria 1544
204 nmdc:mga0rr50_28070_c1 3300050513 Bacteria 3951
205 nmdc:mga0a205_133897_c1 3300050515 Bacteria 2379
206 nmdc:mga0a205_16410_c1 3300050515 Bacteria 6937
207 Ga0501084_0030053 3300054114 Bacteria 4545
208 Ga0501084_0055015 3300054114 Bacteria 3329
209 Ga0501084_0171459 3300054114 Bacteria 1831
210 Ga0590071_005384 3300059421 Bacteria 3079
211 Ga0590071_007195 3300059421 Bacteria 2635
212 Ga0501082_0008380 3300060353 Bacteria 8917
213 Ga0501082_0106283 3300060353 Bacteria 2428
214 Ga0501082_0189769 3300060353 Bacteria 1788
215 Ga0530510_0039160 3300061734 Bacteria 3421
216 Ga0530510_0193621 3300061734 Bacteria 1509
217 Ga0530510_0274213 3300061734 Bacteria 1259
218 Ga0530510_0353825 3300061734 Bacteria 1103
219 2559432458 2558860280 Bacteria 11429938
220 Ga0466972_0132908
221 JGI25406J46586_10008226
222 Ga0070658_10091632
223 Ga0070683_100009679
224 Ga0070683_100017145
225 Ga0070682_100313431
226 Ga0070660_100060618
227 Ga0070661_100020163
228 Ga0070692_10060200
229 Ga0070671_100043151
230 Ga0070673_100187187
231 Ga0070659_100085061
232 Ga0070708_100064629
233 Ga0070681_10002997
234 Ga0070681_10049991
235 Ga0070685_10048877
236 Ga0070706_100091793
237 Ga0070706_100549766
238 Ga0070707_100333030
239 Ga0070698_100020569
240 Ga0070698_100031264
241 Ga0070698_100031640
242 Ga0070698_100679941
243 Ga0070699_100012069
244 Ga0070699_100192520
245 Ga0070684_100018623
246 Ga0070684_100080824
247 Ga0068853_100164547
248 Ga0070672_100078262
249 Ga0070704_100008098
250 Ga0070664_100064427
251 Ga0068854_100272424
252 Ga0068856_100148541
253 Ga0068856_100183356
254 Ga0068861_100703097
255 Ga0068870_10077418
256 Ga0068870_10158719
257 Ga0081539_10000288
258 Ga0068871_100228728
259 Ga0075428_100351078
260 Ga0075430_100241167
261 Ga0075431_100000945
262 Ga0075431_100438046
263 Ga0075433_10311913
264 Ga0075434_100006888
265 Ga0075429_100030191
266 Ga0068865_100186494
267 Ga0075435_100025330
268 Ga0111539_10054651
269 Ga0111539_10125668
270 Ga0111539_10440256
271 Ga0105245_10176400
272 Ga0105245_10184503
273 Ga0114129_10009127
274 Ga0114129_10048838
275 Ga0114129_10053136
276 Ga0114129_10424196
277 Ga0105243_10006249
278 Ga0105243_10475816
279 Ga0105241_10119260
280 Ga0105248_10307858
281 Ga0105238_10388112
282 Ga0105249_10614563
283 Ga0105239_10060251
284 Ga0105239_10181171
285 Ga0105246_10029587
286 Ga0157369_10007590
287 Ga0157372_10008513
288 Ga0157372_10143592
289 Ga0157375_10123284
290 Ga0157380_10051542
291 Ga0157377_10129673
292 Ga0157379_10419491
293 Ga0207643_10061536
294 Ga0207705_10071576
295 Ga0207707_10050103
296 Ga0207707_10126113
297 Ga0207660_10016260
298 Ga0207657_10161849
299 Ga0207649_10051920
300 Ga0207652_10118733
301 Ga0207646_10096305
302 Ga0207694_10153378
303 Ga0207690_10276460
304 Ga0207686_10074999
305 Ga0207709_10045908
306 Ga0207691_10038678
307 Ga0207661_10009019
308 Ga0207661_10099720
309 Ga0207679_10100818
310 Ga0207640_10046517
311 Ga0207639_10232523
312 Ga0207708_10125009
313 Ga0207708_10177697
314 Ga0207702_10120688
315 Ga0207674_10036714
316 Ga0307408_100608393
317 Ga0307405_10043950
318 Ga0307405_10060239
319 Ga0316577_10067150
320 Ga0307413_10012878
321 Ga0307413_10066407
322 Ga0307413_10071639
323 Ga0307410_10316608
324 Ga0307407_10092092
325 Ga0307407_10139698
326 Ga0307409_100049477
327 Ga0307409_100147258
328 Ga0307409_100189737
329 Ga0307416_100078367
330 Ga0307416_100126895
331 Ga0307416_100140481
332 Ga0307414_10156700
333 Ga0307414_10246943
334 Ga0307414_10335381
335 Ga0307411_10088807
336 Ga0307411_10547650
337 Ga0307415_100150234
338 Ga0373935_0045935
339 Ga0373927_0004307
340 Ga0316582_0094976
341 Ga0316582_0428700
342 Ga0316584_0053308
343 Ga0373925_0000325
344 Ga0316581_0100002
345 Ga0400489_03561
346 Ga0436365_1442746
347 Ga0436360_0257603
348 Ga0436362_0134411
349 Ga0451853_1675534
350 Ga0439446_0017025
351 Ga0439446_0095684
352 Ga0453683_0001432
353 Ga0453683_0031704
354 Ga0453683_0053927
355 Ga0466968_0054497
356 Ga0466960_0249433
357 Ga0451576_0004218
358 Ga0466958_0031688
359 Ga0496104_0151249
360 Ga0496104_0202878
361 Ga0496105_0149522
362 Ga0496105_0520243
363 Ga0496108_0332437
364 Ga0496109_0001867
365 Ga0496110_0012412
366 Ga0496111_0001818
367 Ga0501031_0233220
368 Ga0501033_0087519
369 Ga0501034_0001501
370 Ga0501034_0007612
371 Ga0501034_0016884
372 Ga0501034_0079660
373 Ga0501036_0133822
374 Ga0501036_0351427
375 Ga0501037_0232762
376 Ga0501039_0090317
377 Ga0501039_0364642
378 Ga0501039_0396973
379 Ga0501040_0137069
380 Ga0501040_0371412
381 Ga0501041_0094474
382 Ga0501042_0094612
383 Ga0501042_0100285
384 Ga0501046_0239199
385 Ga0501048_0083921
386 Ga0501048_0426504
387 Ga0501067_0016793
388 Ga0501068_0236630
389 Ga0501069_0046082
390 Ga0501069_0080333
391 Ga0501071_0027145
392 Ga0501071_0040676
393 Ga0501071_0140985
394 Ga0501072_0021888
395 Ga0501072_0127242
396 Ga0501072_0204293
397 Ga0501075_0005659
398 Ga0501076_0023529
399 Ga0501076_0056732
400 Ga0501076_0088428
401 Ga0501076_0113964
402 Ga0501077_0024331
403 Ga0501077_0032315
404 Ga0501077_0039325
405 Ga0501077_0147967
406 Ga0501079_0009233
407 Ga0501079_0066325
408 Ga0501079_0269148
409 Ga0501080_0139305
410 Ga0501080_0210778
411 Ga0501081_0055748
412 Ga0501081_0145518
413 Ga0501045_0034608
414 Ga0501045_0081435
415 Ga0501045_0110121
416 Ga0501045_0196981
417 nmdc:mga05p37_117648_c1
418 nmdc:mga09592_27104_c1
419 nmdc:mga0qj67_140581_c1
420 nmdc:mga06r32_1190_c1
421 nmdc:mga08y16_43697_c1
422 nmdc:mga0n895_330819_c1
423 nmdc:mga0rr50_28070_c1
424 nmdc:mga0a205_133897_c1
425 nmdc:mga0a205_16410_c1
426 Ga0501084_0030053
427 Ga0501084_0055015
428 Ga0501084_0171459
429 Ga0590071_005384
430 Ga0590071_007195
431 Ga0501082_0008380
432 Ga0501082_0106283
433 Ga0501082_0189769
434 Ga0530510_0039160
435 Ga0530510_0193621
436 Ga0530510_0274213
437 Ga0530510_0353825
438 2559432458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

54

293

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9787 2 255
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9784 2 255
7bmm-assembly2.cif.gz_C crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form 0.9677 1 266
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9674 2 255
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9671 2 255
ID Description Score Start End Superfamily
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9772 2 256 3.40.50.300
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.97 1 266 3.40.50.300
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9664 1 266 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9514 2 256 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9453 2 255 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V8YVV4-F1-model_v4 Polyphosphate kinase 2 family protein 0.9909 1 256 GO:0006797
GO:0008976
AF-A0A3A0D950-F1-model_v4 Polyphosphate kinase 0.9851 110 266 GO:0016301
AF-A0A6M0HTE2-F1-model_v4 Polyphosphate kinase 2 family protein 0.9846 6 266 GO:0006754
GO:0006797
GO:0016301
GO:0016776
AF-A0A2N5KPY5-F1-model_v4 Polyphosphate kinase 0.9831 5 266 GO:0006797
GO:0016301
GO:0016776
AF-A0A6J6NHM5-F1-model_v4 Unannotated protein 0.9829 6 266 GO:0006797
GO:0008976

Map