F331340

General Info

Members Datasets Scaffolds Average Seq Length
219 152 438 253

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0443486|Ga0436361_0443486_1017_1880
Length 287
Sequence MTGFSRADPTGSEPGGAGIGQDFRGMLGREMKALNSNPPRRKTSGLAENIKTFVYAILIALGIRTVAFEPFNIPSGSMIPTLLVGDYLFVSKYSYGYSRYSLPLGLPLIPGRILVTPPKRGDVAVFKLPSDNKTDYIKRIIGLPGDRIQMKGGRLYINEQMAERGNPVSFEYADGFGNFTRGTQYIETLPNGVKHRIIQIDDDEGTFDNTKVYDVPPGHYFMMGDNRDNSSDSRIPADQGGVGYVPFENLIGRAEIIFFSIREDTPAWEVWRWPWDVRWGRIFERVH

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
72 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
148 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
149 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
150 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
151 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
152 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.69
Metatranscriptomes 4.57
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.65
Nodule 0
Rhizoplane 0.91
Rhizosphere 89.04
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0443486 3300039447 Bacteria 1953
2 JGI25151J46595_10000925 3300003187 Bacteria 22805
3 JGI25151J46595_10002219 3300003187 Bacteria 11999
4 JGI25406J46586_10000833 3300003203 Bacteria 14480
5 JGI25153J46596_10067839 3300003215 Bacteria 937
6 Ga0070680_100287121 3300005336 Bacteria 1394
7 Ga0070680_100458453 3300005336 Bacteria 1089
8 Ga0070671_100015751 3300005355 Bacteria 6109
9 Ga0070709_10229822 3300005434 Bacteria 1327
10 Ga0070714_100025167 3300005435 Bacteria 4909
11 Ga0070714_100419832 3300005435 Bacteria 1267
12 Ga0070714_100632837 3300005435 Bacteria 1029
13 Ga0070714_100647095 3300005435 Bacteria 1017
14 Ga0070713_100013729 3300005436 Bacteria 5989
15 Ga0070710_10127239 3300005437 Bacteria 1549
16 Ga0070710_10204798 3300005437 Bacteria 1248
17 Ga0070711_100298399 3300005439 Bacteria 1280
18 Ga0070711_100346356 3300005439 Bacteria 1194
19 Ga0070708_100016476 3300005445 Bacteria 6134
20 Ga0070681_10033348 3300005458 Bacteria 5169
21 Ga0070681_10049649 3300005458 Bacteria 4189
22 Ga0070681_10071885 3300005458 Bacteria 3424
23 Ga0070706_100010926 3300005467 Bacteria 8431
24 Ga0070706_100121457 3300005467 Bacteria 2435
25 Ga0070707_100003078 3300005468 Bacteria 15795
26 Ga0070698_100017265 3300005471 Bacteria 7604
27 Ga0070699_100027704 3300005518 Bacteria 4885
28 Ga0070699_100187108 3300005518 Bacteria 1839
29 Ga0070679_100030063 3300005530 Bacteria 5361
30 Ga0070679_100212404 3300005530 Bacteria 1898
31 Ga0070697_100004216 3300005536 Bacteria 11013
32 Ga0070696_100217533 3300005546 Bacteria 1432
33 Ga0070665_100004744 3300005548 Bacteria 14149
34 Ga0068855_100190758 3300005563 Bacteria 2312
35 Ga0068855_100298682 3300005563 Bacteria 1784
36 Ga0070664_100090740 3300005564 Bacteria 2644
37 Ga0068856_100300049 3300005614 Bacteria 1624
38 Ga0081540_1015668 3300005983 Bacteria 4787
39 Ga0081539_10000626 3300005985 Bacteria 71615
40 Ga0070717_10014876 3300006028 Bacteria 5990
41 Ga0070717_10102653 3300006028 Bacteria 2430
42 Ga0070717_10249764 3300006028 Bacteria 1567
43 Ga0070717_10279400 3300006028 Bacteria 1481
44 Ga0070716_100244066 3300006173 Bacteria 1220
45 Ga0070712_100006946 3300006175 Bacteria 7057
46 Ga0070712_100300809 3300006175 Bacteria 1298
47 Ga0070712_100386764 3300006175 Bacteria 1153
48 Ga0075436_100057556 3300006914 Bacteria 2684
49 Ga0099795_10008321 3300007788 Bacteria 2952
50 Ga0099795_10027847 3300007788 Bacteria 1916
51 Ga0105245_10344491 3300009098 Bacteria 1475
52 Ga0105248_10132305 3300009177 Bacteria 2814
53 Ga0105238_10942408 3300009551 Bacteria 883
54 Ga0099796_10006917 3300010159 Bacteria 2934
55 Ga0099796_10021323 3300010159 Bacteria 1993
56 Ga0099796_10023553 3300010159 Bacteria 1923
57 Ga0105239_10127787 3300010375 Bacteria 2826
58 Ga0105239_10277034 3300010375 Bacteria 1888
59 Ga0157370_10292089 3300013104 Bacteria 1506
60 Ga0163162_10335518 3300013306 Bacteria 1644
61 Ga0163163_10340999 3300014325 Bacteria 1554
62 Ga0182008_10018658 3300014497 Bacteria 3590
63 Ga0182007_10029705 3300015262 Bacteria 1871
64 Ga0206352_10545523 3300020078 Bacteria 1006
65 Ga0213873_10002634 3300021358 Bacteria 3130
66 Ga0213875_10000114 3300021388 Bacteria 91363
67 Ga0213875_10001241 3300021388 Bacteria 17201
68 Ga0213875_10016897 3300021388 Bacteria 3534
69 Ga0209130_1000469 3300025284 Bacteria 41793
70 Ga0209025_1001114 3300025294 Bacteria 38519
71 Ga0209758_1019702 3300025297 Bacteria 3237
72 Ga0207426_1000065 3300025302 Bacteria 353625
73 Ga0207692_10299129 3300025898 Bacteria 979
74 Ga0207699_10021787 3300025906 Bacteria 3461
75 Ga0207684_10012328 3300025910 Bacteria 7440
76 Ga0207684_10102599 3300025910 Bacteria 2446
77 Ga0207707_10018652 3300025912 Bacteria 6049
78 Ga0207707_10118834 3300025912 Bacteria 2310
79 Ga0207707_10399943 3300025912 Bacteria 1179
80 Ga0207693_10007596 3300025915 Bacteria 8909
81 Ga0207693_10079002 3300025915 Bacteria 2575
82 Ga0207693_10577811 3300025915 Bacteria 875
83 Ga0207663_10039550 3300025916 Bacteria 2858
84 Ga0207663_10497353 3300025916 Bacteria 947
85 Ga0207660_10061248 3300025917 Bacteria 2708
86 Ga0207652_10040993 3300025921 Bacteria 3934
87 Ga0207694_10361525 3300025924 Bacteria 1203
88 Ga0207700_10147110 3300025928 Bacteria 1943
89 Ga0207700_10202769 3300025928 Unclassified 1672
90 Ga0207664_10024904 3300025929 Bacteria 4500
91 Ga0207644_10013976 3300025931 Bacteria 5365
92 Ga0207665_10049147 3300025939 Bacteria 2833
93 Ga0207665_10069542 3300025939 Bacteria 2401
94 Ga0207665_10194557 3300025939 Bacteria 1475
95 Ga0207711_10249168 3300025941 Bacteria 1631
96 Ga0207679_10062101 3300025945 Bacteria 2783
97 Ga0207639_10029805 3300026041 Bacteria 3999
98 Ga0207702_10263468 3300026078 Bacteria 1624
99 Ga0207702_10731935 3300026078 Bacteria 976
100 Ga0209179_1001556 3300027512 Bacteria 2849
101 Ga0268266_10003259 3300028379 Bacteria 16360
102 Ga0268266_10254612 3300028379 Bacteria 1625
103 Ga0265327_10015003 3300031251 Bacteria 5036
104 Ga0265313_10004947 3300031595 Bacteria 9978
105 Ga0373926_0025578 3300035083 Bacteria 2061
106 Ga0373934_0138482 3300035086 Bacteria 995
107 Ga0373923_0001082 3300035111 Bacteria 7489
108 Ga0373923_0022352 3300035111 Bacteria 2480
109 Ga0373954_0077511 3300035118 Bacteria 1585
110 Ga0373957_0003073 3300035120 Bacteria 4866
111 Ga0373957_0027144 3300035120 Bacteria 2078
112 Ga0373943_0028857 3300035170 Bacteria 2618
113 Ga0373946_0030114 3300035171 Bacteria 2165
114 Ga0373955_0045139 3300035172 Bacteria 2377
115 Ga0373955_0062416 3300035172 Bacteria 2061
116 Ga0373924_0027284 3300035410 Bacteria 2270
117 Ga0373935_0022023 3300035692 Bacteria 3903
118 Ga0373935_0024323 3300035692 Bacteria 3728
119 Ga0373927_0023151 3300035695 Bacteria 4069
120 Ga0373927_0055222 3300035695 Bacteria 2569
121 Ga0373933_0004134 3300035724 Bacteria 7995
122 Ga0373933_0006950 3300035724 Bacteria 6169
123 Ga0373933_0008148 3300035724 Bacteria 5718
124 Ga0373933_0026596 3300035724 Bacteria 3324
125 Ga0373947_0017145 3300035725 Bacteria 4164
126 Ga0373947_0239604 3300035725 Bacteria 1197
127 Ga0373937_0001217 3300036401 Bacteria 21646
128 Ga0373937_0002917 3300036401 Bacteria 14293
129 Ga0373937_0008059 3300036401 Bacteria 9139
130 Ga0373937_0064874 3300036401 Bacteria 3360
131 Ga0373937_0183267 3300036401 Bacteria 1966
132 Ga0373925_0011663 3300037068 Bacteria 6356
133 Ga0373925_0064197 3300037068 Bacteria 2763
134 Ga0395905_0771183 3300037471 Bacteria 864
135 Ga0436364_0169683 3300037853 Bacteria 86149
136 Ga0436364_0284910 3300037853 Bacteria 9863
137 Ga0436364_0658547 3300037853 Bacteria 1469
138 Ga0436364_1206713 3300037853 Bacteria 32706
139 Ga0436365_0210910 3300039437 Bacteria 8015
140 Ga0436360_0056367 3300039438 Bacteria 816
141 Ga0436360_0349318 3300039438 Bacteria 1143
142 Ga0436360_0796877 3300039438 Bacteria 2407
143 Ga0436363_0983116 3300039450 Bacteria 1029
144 Ga0436362_0023937 3300039453 Bacteria 7053
145 Ga0439445_0146925 3300042004 Bacteria 685
146 Ga0453683_0013643 3300044673 Bacteria 5294
147 Ga0453683_0022299 3300044673 Bacteria 4040
148 Ga0466963_0137877 3300044694 Bacteria 1689
149 Ga0466963_0358191 3300044694 Bacteria 1028
150 Ga0453684_0012589 3300044712 Bacteria 13917
151 Ga0453684_0017695 3300044712 Bacteria 11012
152 Ga0453684_0769074 3300044712 Bacteria 1041
153 Ga0466959_0334554 3300045049 Bacteria 1034
154 Ga0451576_0001017 3300045051 Bacteria 51874
155 Ga0451576_0010824 3300045051 Bacteria 10441
156 Ga0451576_0135217 3300045051 Bacteria 2570
157 Ga0451576_0331616 3300045051 Bacteria 1592
158 Ga0495651_0028389 3300046462 Bacteria 4361
159 Ga0495653_0097457 3300046463 Bacteria 2137
160 Ga0495580_0048410 3300046472 Bacteria 3010
161 Ga0495580_0103489 3300046472 Bacteria 1979
162 Ga0495664_0000913 3300046477 Bacteria 15191
163 Ga0495608_0015390 3300046511 Bacteria 5306
164 Ga0495610_0012895 3300046512 Bacteria 4999
165 Ga0495610_0114662 3300046512 Bacteria 1189
166 Ga0495652_0233951 3300046529 Bacteria 1372
167 Ga0495640_0030687 3300046533 Bacteria 3846
168 Ga0495587_0011785 3300046536 Bacteria 5529
169 Ga0495645_0000977 3300046543 Bacteria 19476
170 Ga0495645_0162726 3300046543 Bacteria 1542
171 Ga0495645_0224947 3300046543 Bacteria 1260
172 Ga0495667_0013749 3300046559 Bacteria 5467
173 Ga0495667_0040113 3300046559 Bacteria 3110
174 Ga0495635_0096467 3300046663 Bacteria 2021
175 Ga0495588_0332705 3300046674 Bacteria 799
176 Ga0495657_0167504 3300046675 Bacteria 1355
177 Ga0495599_0059868 3300046678 Bacteria 2382
178 Ga0495623_0065596 3300046679 Bacteria 2270
179 Ga0495647_0157573 3300046681 Bacteria 977
180 Ga0495658_0126791 3300046683 Bacteria 1550
181 Ga0495613_0180996 3300046689 Bacteria 1493
182 Ga0495649_0048338 3300046694 Bacteria 2312
183 Ga0495600_0050309 3300046809 Bacteria 2719
184 Ga0495604_0084778 3300047317 Bacteria 2365
185 Ga0495674_0502067 3300047319 Bacteria 970
186 Ga0495680_0016907 3300047322 Bacteria 6246
187 Ga0495675_0018415 3300047444 Bacteria 4432
188 Ga0495684_0304053 3300047471 Bacteria 1145
189 Ga0495602_0000695 3300048088 Bacteria 31609
190 Ga0496110_0188319 3300048913 Bacteria 1874
191 Ga0496112_0044156 3300048915 Bacteria 4366
192 Ga0501034_0203186 3300049571 Bacteria 1939
193 Ga0501037_0455212 3300049573 Bacteria 872
194 Ga0501070_0088453 3300049586 Bacteria 2564
195 Ga0501083_0018736 3300049744 Bacteria 4821
196 nmdc:mga0n895_388605_c1 3300050512 Bacteria 1411
197 nmdc:mga08x19_626448_c1 3300050514 Bacteria 763
198 Ga0495601_0001469 3300053077 Bacteria 12990
199 Ga0495595_0036510 3300053084 Bacteria 2230
200 Ga0495595_0075980 3300053084 Bacteria 1594
201 Ga0495619_0055765 3300053085 Bacteria 2618
202 Ga0500642_0011828 3300053130 Bacteria 3139
203 Ga0501084_0264171 3300054114 Bacteria 1453
204 Ga0587066_026733 3300059490 Bacteria 999
205 Ga0587070_039992 3300059491 Bacteria 892
206 Ga0587073_0013500 3300059492 Bacteria 1436
207 Ga0587101_028663 3300059623 Bacteria 854
208 Ga0587109_046558 3300059624 Bacteria 877
209 Ga0587068_039205 3300059641 Bacteria 851
210 Ga0587075_019374 3300059644 Bacteria 996
211 Ga0587107_021223 3300059652 Bacteria 908
212 Ga0587071_044134 3300060344 Bacteria 903
213 Ga0501082_0046075 3300060353 Bacteria 3760
214 2821447737 2821443989 Bacteria 7658172
215 2842778161 2842775625 Bacteria 5587290
216 2844533457 2844533157 Bacteria 7517899
217 2883581367 2883577096 Bacteria 4709178
218 2929202627 2929199973 Bacteria 7260745
219 8055910199 8055909800 Bacteria 7278581
220 Ga0436361_0443486
221 JGI25151J46595_10000925
222 JGI25151J46595_10002219
223 JGI25406J46586_10000833
224 JGI25153J46596_10067839
225 Ga0070680_100287121
226 Ga0070680_100458453
227 Ga0070671_100015751
228 Ga0070709_10229822
229 Ga0070714_100025167
230 Ga0070714_100419832
231 Ga0070714_100632837
232 Ga0070714_100647095
233 Ga0070713_100013729
234 Ga0070710_10127239
235 Ga0070710_10204798
236 Ga0070711_100298399
237 Ga0070711_100346356
238 Ga0070708_100016476
239 Ga0070681_10033348
240 Ga0070681_10049649
241 Ga0070681_10071885
242 Ga0070706_100010926
243 Ga0070706_100121457
244 Ga0070707_100003078
245 Ga0070698_100017265
246 Ga0070699_100027704
247 Ga0070699_100187108
248 Ga0070679_100030063
249 Ga0070679_100212404
250 Ga0070697_100004216
251 Ga0070696_100217533
252 Ga0070665_100004744
253 Ga0068855_100190758
254 Ga0068855_100298682
255 Ga0070664_100090740
256 Ga0068856_100300049
257 Ga0081540_1015668
258 Ga0081539_10000626
259 Ga0070717_10014876
260 Ga0070717_10102653
261 Ga0070717_10249764
262 Ga0070717_10279400
263 Ga0070716_100244066
264 Ga0070712_100006946
265 Ga0070712_100300809
266 Ga0070712_100386764
267 Ga0075436_100057556
268 Ga0099795_10008321
269 Ga0099795_10027847
270 Ga0105245_10344491
271 Ga0105248_10132305
272 Ga0105238_10942408
273 Ga0099796_10006917
274 Ga0099796_10021323
275 Ga0099796_10023553
276 Ga0105239_10127787
277 Ga0105239_10277034
278 Ga0157370_10292089
279 Ga0163162_10335518
280 Ga0163163_10340999
281 Ga0182008_10018658
282 Ga0182007_10029705
283 Ga0206352_10545523
284 Ga0213873_10002634
285 Ga0213875_10000114
286 Ga0213875_10001241
287 Ga0213875_10016897
288 Ga0209130_1000469
289 Ga0209025_1001114
290 Ga0209758_1019702
291 Ga0207426_1000065
292 Ga0207692_10299129
293 Ga0207699_10021787
294 Ga0207684_10012328
295 Ga0207684_10102599
296 Ga0207707_10018652
297 Ga0207707_10118834
298 Ga0207707_10399943
299 Ga0207693_10007596
300 Ga0207693_10079002
301 Ga0207693_10577811
302 Ga0207663_10039550
303 Ga0207663_10497353
304 Ga0207660_10061248
305 Ga0207652_10040993
306 Ga0207694_10361525
307 Ga0207700_10147110
308 Ga0207700_10202769
309 Ga0207664_10024904
310 Ga0207644_10013976
311 Ga0207665_10049147
312 Ga0207665_10069542
313 Ga0207665_10194557
314 Ga0207711_10249168
315 Ga0207679_10062101
316 Ga0207639_10029805
317 Ga0207702_10263468
318 Ga0207702_10731935
319 Ga0209179_1001556
320 Ga0268266_10003259
321 Ga0268266_10254612
322 Ga0265327_10015003
323 Ga0265313_10004947
324 Ga0373926_0025578
325 Ga0373934_0138482
326 Ga0373923_0001082
327 Ga0373923_0022352
328 Ga0373954_0077511
329 Ga0373957_0003073
330 Ga0373957_0027144
331 Ga0373943_0028857
332 Ga0373946_0030114
333 Ga0373955_0045139
334 Ga0373955_0062416
335 Ga0373924_0027284
336 Ga0373935_0022023
337 Ga0373935_0024323
338 Ga0373927_0023151
339 Ga0373927_0055222
340 Ga0373933_0004134
341 Ga0373933_0006950
342 Ga0373933_0008148
343 Ga0373933_0026596
344 Ga0373947_0017145
345 Ga0373947_0239604
346 Ga0373937_0001217
347 Ga0373937_0002917
348 Ga0373937_0008059
349 Ga0373937_0064874
350 Ga0373937_0183267
351 Ga0373925_0011663
352 Ga0373925_0064197
353 Ga0395905_0771183
354 Ga0436364_0169683
355 Ga0436364_0284910
356 Ga0436364_0658547
357 Ga0436364_1206713
358 Ga0436365_0210910
359 Ga0436360_0056367
360 Ga0436360_0349318
361 Ga0436360_0796877
362 Ga0436363_0983116
363 Ga0436362_0023937
364 Ga0439445_0146925
365 Ga0453683_0013643
366 Ga0453683_0022299
367 Ga0466963_0137877
368 Ga0466963_0358191
369 Ga0453684_0012589
370 Ga0453684_0017695
371 Ga0453684_0769074
372 Ga0466959_0334554
373 Ga0451576_0001017
374 Ga0451576_0010824
375 Ga0451576_0135217
376 Ga0451576_0331616
377 Ga0495651_0028389
378 Ga0495653_0097457
379 Ga0495580_0048410
380 Ga0495580_0103489
381 Ga0495664_0000913
382 Ga0495608_0015390
383 Ga0495610_0012895
384 Ga0495610_0114662
385 Ga0495652_0233951
386 Ga0495640_0030687
387 Ga0495587_0011785
388 Ga0495645_0000977
389 Ga0495645_0162726
390 Ga0495645_0224947
391 Ga0495667_0013749
392 Ga0495667_0040113
393 Ga0495635_0096467
394 Ga0495588_0332705
395 Ga0495657_0167504
396 Ga0495599_0059868
397 Ga0495623_0065596
398 Ga0495647_0157573
399 Ga0495658_0126791
400 Ga0495613_0180996
401 Ga0495649_0048338
402 Ga0495600_0050309
403 Ga0495604_0084778
404 Ga0495674_0502067
405 Ga0495680_0016907
406 Ga0495675_0018415
407 Ga0495684_0304053
408 Ga0495602_0000695
409 Ga0496110_0188319
410 Ga0496112_0044156
411 Ga0501034_0203186
412 Ga0501037_0455212
413 Ga0501070_0088453
414 Ga0501083_0018736
415 nmdc:mga0n895_388605_c1
416 nmdc:mga08x19_626448_c1
417 Ga0495601_0001469
418 Ga0495595_0036510
419 Ga0495595_0075980
420 Ga0495619_0055765
421 Ga0500642_0011828
422 Ga0501084_0264171
423 Ga0587066_026733
424 Ga0587070_039992
425 Ga0587073_0013500
426 Ga0587101_028663
427 Ga0587109_046558
428 Ga0587068_039205
429 Ga0587075_019374
430 Ga0587107_021223
431 Ga0587071_044134
432 Ga0501082_0046075
433 2821447737
434 2842778161
435 2844533457
436 2883581367
437 2929202627
438 8055910199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

46

259

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5woe-assembly1.cif.gz_A solution structure of the sorting nexin 25 phox-homology domain 0.7845 131 174
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7485 40 227
4p2j-assembly2.cif.gz_B crystal structure of the mouse snx19 px domain with bound sulphate ion 0.7265 133 174
3k92-assembly1.cif.gz_E crystal structure of a e93k mutant of the majour bacillus subtilis glutamate dehydrogenase rocg 0.7129 134 158
4p2j-assembly1.cif.gz_A crystal structure of the mouse snx19 px domain with bound sulphate ion 0.7084 134 174
ID Description Score Start End Superfamily
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8064 39 251 2.10.109.10
af_G5EF63_587_717_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7789 133 175 3.30.1520.10
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7704 39 251 2.10.109.10
af_A0A5K1K8B7_164_341_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7633 89 227 2.10.109.10
af_A0A0P0VT29_3_120_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.759 89 227 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A443G007-F1-model_v4 deleted 0.9026 91 224
AF-A0A7C1SX00-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8972 91 256 GO:0004252
GO:0006465
GO:0016020
AF-A0A1S6XGL1-F1-model_v4 deleted 0.8936 34 254
AF-A0A4Y6VBE5-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8929 27 256 GO:0004252
GO:0006465
GO:0016020
AF-A0A6A6K0D2-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.8917 40 254 GO:0003954
GO:0004252
GO:0006465
GO:0009060
GO:0016020
GO:0046872
GO:0051539

Map