F331277

General Info

Members Datasets Scaffolds Average Seq Length
219 142 438 131

Family's Representative Sequence

Representative Sequence 3300034819|Ga0373958_0090572|Ga0373958_0090572_33_482
Length 149
Sequence MGEAGAGTRPPALGLRHVALTVADLEACERFYVGVLGFVVEWRPDPDNVYLRLAGDNLALHRYEPPPGAVDGGDEAAFRARRGQHLAHFGILVKRPEEVDAWAAHLRAHGVAAPEPRTHRDGARSFYAADPDGNAIQFLYHPPISDPTP

Samples

Sample ID Description Type Environment
1 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
83 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
89 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
90 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 3.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.37
Rhizosphere 98.17
Stem 0
Stem Tuber 0
Unclassified 27.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373958_0090572 3300034819 Unclassified 705
2 Ga0065712_10132060 3300005290 Bacteria 1538
3 Ga0065712_10440724 3300005290 Bacteria 657
4 Ga0065712_10441528 3300005290 Unclassified 694
5 Ga0065715_10366349 3300005293 Unclassified 927
6 Ga0070658_11536943 3300005327 Bacteria 577
7 Ga0070683_100707548 3300005329 Unclassified 965
8 Ga0070690_100005422 3300005330 Bacteria 7164
9 Ga0070670_100000432 3300005331 Bacteria 34351
10 Ga0070670_100538420 3300005331 Bacteria 1041
11 Ga0070677_10229407 3300005333 Bacteria 911
12 Ga0070666_10003713 3300005335 Bacteria 9253
13 Ga0068868_100003567 3300005338 Bacteria 10835
14 Ga0070689_100296344 3300005340 Bacteria 1345
15 Ga0070689_101249255 3300005340 Unclassified 668
16 Ga0070661_100006162 3300005344 Bacteria 8268
17 Ga0070675_100660829 3300005354 Unclassified 950
18 Ga0070671_100046329 3300005355 Bacteria 3616
19 Ga0070673_100013644 3300005364 Bacteria 5630
20 Ga0070673_100090082 3300005364 Bacteria 2505
21 Ga0070688_100026509 3300005365 Bacteria 3444
22 Ga0070688_100511725 3300005365 Unclassified 907
23 Ga0070667_100000788 3300005367 Bacteria 29712
24 Ga0070713_100380520 3300005436 Bacteria 1315
25 Ga0070700_100972810 3300005441 Bacteria 696
26 Ga0070694_100138334 3300005444 Bacteria 1766
27 Ga0070694_101374361 3300005444 Bacteria 595
28 Ga0070662_100422933 3300005457 Unclassified 1102
29 Ga0068867_100268754 3300005459 Bacteria 1393
30 Ga0070685_10078888 3300005466 Bacteria 1969
31 Ga0070707_100023562 3300005468 Bacteria 5822
32 Ga0070707_100511309 3300005468 Bacteria 1163
33 Ga0070699_100449835 3300005518 Bacteria 1168
34 Ga0070679_100541292 3300005530 Unclassified 1108
35 Ga0070684_100141418 3300005535 Unclassified 2176
36 Ga0068853_101112526 3300005539 Unclassified 762
37 Ga0070672_100140215 3300005543 Unclassified 1993
38 Ga0068855_100653535 3300005563 Bacteria 1129
39 Ga0070664_100001117 3300005564 Bacteria 21207
40 Ga0068859_100102127 3300005617 Bacteria 2925
41 Ga0068864_100000615 3300005618 Bacteria 30078
42 Ga0068863_100300331 3300005841 Bacteria 1557
43 Ga0068858_100008151 3300005842 Bacteria 10072
44 Ga0068858_101885391 3300005842 Bacteria 591
45 Ga0068860_102397530 3300005843 Bacteria 548
46 Ga0097621_100078028 3300006237 Unclassified 2750
47 Ga0097621_100100313 3300006237 Bacteria 2435
48 Ga0097621_100245733 3300006237 Unclassified 1566
49 Ga0068871_100045869 3300006358 Bacteria 3519
50 Ga0068871_100125859 3300006358 Bacteria 2169
51 Ga0068871_100370354 3300006358 Bacteria 1270
52 Ga0068871_100418454 3300006358 Unclassified 1196
53 Ga0075431_100504321 3300006847 Bacteria 1201
54 Ga0075434_100005632 3300006871 Bacteria 11421
55 Ga0075434_100025941 3300006871 Bacteria 5737
56 Ga0075436_100083679 3300006914 Bacteria 2214
57 Ga0075436_100342762 3300006914 Bacteria 1076
58 Ga0097620_100102130 3300006931 Bacteria 2925
59 Ga0075435_100032165 3300007076 Bacteria 4141
60 Ga0111539_10098018 3300009094 Bacteria 3444
61 Ga0111539_10706606 3300009094 Bacteria 1173
62 Ga0114129_10032448 3300009147 Bacteria 7381
63 Ga0114129_10044388 3300009147 Bacteria 6253
64 Ga0114129_10073152 3300009147 Bacteria 4775
65 Ga0114129_11841247 3300009147 Bacteria 735
66 Ga0105242_10081396 3300009176 Bacteria 2708
67 Ga0105248_10015114 3300009177 Bacteria 8501
68 Ga0105248_11497318 3300009177 Unclassified 764
69 Ga0105249_11804592 3300009553 Unclassified 684
70 Ga0105246_10026699 3300011119 Bacteria 3777
71 Ga0157374_10448405 3300013296 Unclassified 1291
72 Ga0157378_11856077 3300013297 Bacteria 651
73 Ga0163162_10011703 3300013306 Bacteria 8556
74 Ga0157372_10124258 3300013307 Bacteria 2966
75 Ga0157375_10001506 3300013308 Bacteria 20019
76 Ga0157375_10203730 3300013308 Unclassified 2135
77 Ga0157375_10723097 3300013308 Bacteria 1148
78 Ga0163163_10025019 3300014325 Bacteria 5687
79 Ga0163163_10031572 3300014325 Bacteria 5113
80 Ga0163163_10388556 3300014325 Unclassified 1453
81 Ga0163163_11717270 3300014325 Unclassified 688
82 Ga0157377_10480822 3300014745 Bacteria 864
83 Ga0157379_10043783 3300014968 Bacteria 3997
84 Ga0157376_10063107 3300014969 Bacteria 3120
85 Ga0163161_10122102 3300017792 Bacteria 1958
86 Ga0163161_11431847 3300017792 Unclassified 604
87 Ga0207680_10006049 3300025903 Bacteria 5828
88 Ga0207649_10008176 3300025920 Bacteria 5696
89 Ga0207646_10018574 3300025922 Bacteria 6482
90 Ga0207650_10006302 3300025925 Bacteria 8086
91 Ga0207650_10431442 3300025925 Bacteria 1095
92 Ga0207659_10524427 3300025926 Unclassified 1005
93 Ga0207670_10174435 3300025936 Bacteria 1614
94 Ga0207691_10117625 3300025940 Unclassified 2358
95 Ga0207661_10203706 3300025944 Unclassified 1741
96 Ga0207679_10003716 3300025945 Bacteria 9464
97 Ga0207651_10011752 3300025960 Bacteria 4914
98 Ga0207651_10113238 3300025960 Bacteria 2041
99 Ga0207658_10005751 3300025986 Bacteria 8479
100 Ga0207677_10005084 3300026023 Bacteria 7110
101 Ga0207677_10709996 3300026023 Bacteria 893
102 Ga0207703_10021065 3300026035 Bacteria 5101
103 Ga0207703_10080098 3300026035 Bacteria 2719
104 Ga0207708_10693245 3300026075 Bacteria 870
105 Ga0207641_10049008 3300026088 Bacteria 3568
106 Ga0207641_10138797 3300026088 Unclassified 2190
107 Ga0207648_10083192 3300026089 Bacteria 2791
108 Ga0207676_10000283 3300026095 Bacteria 43770
109 Ga0207683_10413898 3300026121 Bacteria 1241
110 Ga0265319_1016435 3300028563 Bacteria 2838
111 Ga0265334_10011288 3300028573 Bacteria 3764
112 Ga0265338_10009532 3300028800 Bacteria 11559
113 Ga0265313_10074444 3300031595 Unclassified 1557
114 Ga0316575_10004901 3300031665 Bacteria 4729
115 Ga0316575_10034455 3300031665 Bacteria 1989
116 Ga0316579_10000832 3300031691 Bacteria 10658
117 Ga0316576_10067834 3300031727 Bacteria 2627
118 Ga0316576_10109534 3300031727 Bacteria 2070
119 Ga0316578_10015990 3300031728 Bacteria 4050
120 Ga0316578_10143098 3300031728 Bacteria 1440
121 Ga0316577_10024227 3300031733 Bacteria 3373
122 Ga0316577_10212582 3300031733 Unclassified 1093
123 Ga0316583_10000732 3300032133 Bacteria 10221
124 Ga0316585_10000930 3300032137 Bacteria 7500
125 Ga0316585_10068264 3300032137 Unclassified 1153
126 Ga0316585_10090635 3300032137 Bacteria 999
127 Ga0316585_10136832 3300032137 Unclassified 808
128 Ga0316585_10328262 3300032137 Unclassified 509
129 Ga0316580_10000571 3300032139 Bacteria 8632
130 Ga0316593_10017799 3300032168 Bacteria 2172
131 Ga0316593_10038719 3300032168 Bacteria 1579
132 Ga0316593_10045114 3300032168 Bacteria 1477
133 Ga0316593_10120045 3300032168 Unclassified 943
134 Ga0316593_10391390 3300032168 Bacteria 536
135 Ga0316592_1057463 3300033524 Bacteria 872
136 Ga0316596_1015987 3300033541 Bacteria 1877
137 Ga0316596_1033058 3300033541 Bacteria 1347
138 Ga0373923_0038417 3300035111 Unclassified 1962
139 Ga0373923_0346481 3300035111 Unclassified 709
140 Ga0373939_0078287 3300035114 Unclassified 1093
141 Ga0373954_0261601 3300035118 Unclassified 852
142 Ga0373943_0096649 3300035170 Bacteria 1538
143 Ga0373955_0582324 3300035172 Unclassified 685
144 Ga0373955_0626413 3300035172 Unclassified 659
145 Ga0373962_0149220 3300035242 Unclassified 764
146 Ga0316574_0010258 3300035398 Bacteria 5284
147 Ga0316574_0045189 3300035398 Bacteria 2727
148 Ga0316574_0088794 3300035398 Bacteria 1969
149 Ga0373924_0083443 3300035410 Unclassified 1361
150 Ga0373931_0079934 3300035691 Bacteria 1802
151 Ga0373933_0755419 3300035724 Unclassified 640
152 Ga0373933_0806596 3300035724 Bacteria 618
153 Ga0373937_0035578 3300036401 Unclassified 4534
154 Ga0373937_0052627 3300036401 Bacteria 3734
155 Ga0373937_0070075 3300036401 Bacteria 3234
156 Ga0373937_0110124 3300036401 Bacteria 2561
157 Ga0373937_0467982 3300036401 Bacteria 1197
158 Ga0316582_0008555 3300036647 Bacteria 5509
159 Ga0316582_0011568 3300036647 Bacteria 4886
160 Ga0316582_0035735 3300036647 Bacteria 3071
161 Ga0316582_0057799 3300036647 Bacteria 2479
162 Ga0316582_0111522 3300036647 Unclassified 1821
163 Ga0316582_0249471 3300036647 Bacteria 1216
164 Ga0316582_0257013 3300036647 Bacteria 1197
165 Ga0316582_0732979 3300036647 Unclassified 678
166 Ga0316584_0015347 3300036712 Bacteria 5477
167 Ga0316584_0020856 3300036712 Bacteria 4758
168 Ga0316584_0028328 3300036712 Bacteria 4129
169 Ga0316584_0179069 3300036712 Bacteria 1570
170 Ga0316584_0297826 3300036712 Bacteria 1168
171 Ga0316584_0448989 3300036712 Unclassified 912
172 Ga0316584_1070037 3300036712 Unclassified 536
173 Ga0395905_0015175 3300037471 Bacteria 7331
174 Ga0316581_0141812 3300037588 Unclassified 741
175 Ga0436361_0722658 3300039447 Bacteria 1864
176 Ga0436362_0446138 3300039453 Unclassified 902
177 Ga0451839_1262373 3300041496 Unclassified 674
178 Ga0451577_0740486 3300042876 Bacteria 889
179 Ga0453683_0303895 3300044673 Bacteria 1021
180 Ga0453684_0336408 3300044712 Bacteria 1706
181 Ga0451576_0020554 3300045051 Bacteria 7186
182 Ga0495592_0035520 3300046454 Unclassified 3756
183 Ga0495651_0932128 3300046462 Unclassified 530
184 Ga0495580_0951883 3300046472 Unclassified 550
185 Ga0495618_0227811 3300046514 Unclassified 1174
186 Ga0495618_0350750 3300046514 Bacteria 909
187 Ga0495630_1068827 3300046517 Bacteria 612
188 Ga0495586_0161725 3300046535 Bacteria 1263
189 Ga0495645_0510940 3300046543 Bacteria 750
190 Ga0495667_0004067 3300046559 Bacteria 9830
191 Ga0495657_0006300 3300046675 Bacteria 9296
192 Ga0495613_0045762 3300046689 Bacteria 3235
193 Ga0495613_0059401 3300046689 Bacteria 2803
194 Ga0495600_0157496 3300046809 Unclassified 1469
195 Ga0495581_0030450 3300047315 Bacteria 3127
196 Ga0495581_0217244 3300047315 Bacteria 1118
197 Ga0495675_0227601 3300047444 Unclassified 1126
198 Ga0496109_1586125 3300048912 Unclassified 589
199 Ga0496110_1738865 3300048913 Unclassified 534
200 Ga0496115_0502741 3300048918 Bacteria 974
201 Ga0501034_0052929 3300049571 Bacteria 4089
202 Ga0501071_0796386 3300049587 Bacteria 729
203 Ga0501080_1137236 3300049742 Bacteria 673
204 Ga0501035_1032872 3300049822 Bacteria 645
205 Ga0501044_0093787 3300049823 Bacteria 3027
206 nmdc:mga05p37_1524470_c1 3300050507 Bacteria 664
207 nmdc:mga05p37_172735_c1 3300050507 Bacteria 2635
208 nmdc:mga05p37_383402_c1 3300050507 Bacteria 1646
209 nmdc:mga05p37_794908_c1 3300050507 Archaea 1036
210 nmdc:mga0n895_176199_c1 3300050512 Archaea 2169
211 nmdc:mga0n895_7257_c1 3300050512 Bacteria 9493
212 nmdc:mga0rr50_24392_c1 3300050513 Bacteria 4188
213 nmdc:mga0rr50_45092_c1 3300050513 Bacteria 3238
214 nmdc:mga0a205_1462703_c1 3300050515 Unclassified 531
215 nmdc:mga0a205_73493_c1 3300050515 Bacteria 3303
216 Ga0495601_0149498 3300053077 Bacteria 1525
217 Ga0495601_0634681 3300053077 Unclassified 684
218 Ga0495619_0127664 3300053085 Unclassified 1746
219 Ga0530510_1475335 3300061734 Bacteria 522
220 Ga0373958_0090572
221 Ga0065712_10132060
222 Ga0065712_10440724
223 Ga0065712_10441528
224 Ga0065715_10366349
225 Ga0070658_11536943
226 Ga0070683_100707548
227 Ga0070690_100005422
228 Ga0070670_100000432
229 Ga0070670_100538420
230 Ga0070677_10229407
231 Ga0070666_10003713
232 Ga0068868_100003567
233 Ga0070689_100296344
234 Ga0070689_101249255
235 Ga0070661_100006162
236 Ga0070675_100660829
237 Ga0070671_100046329
238 Ga0070673_100013644
239 Ga0070673_100090082
240 Ga0070688_100026509
241 Ga0070688_100511725
242 Ga0070667_100000788
243 Ga0070713_100380520
244 Ga0070700_100972810
245 Ga0070694_100138334
246 Ga0070694_101374361
247 Ga0070662_100422933
248 Ga0068867_100268754
249 Ga0070685_10078888
250 Ga0070707_100023562
251 Ga0070707_100511309
252 Ga0070699_100449835
253 Ga0070679_100541292
254 Ga0070684_100141418
255 Ga0068853_101112526
256 Ga0070672_100140215
257 Ga0068855_100653535
258 Ga0070664_100001117
259 Ga0068859_100102127
260 Ga0068864_100000615
261 Ga0068863_100300331
262 Ga0068858_100008151
263 Ga0068858_101885391
264 Ga0068860_102397530
265 Ga0097621_100078028
266 Ga0097621_100100313
267 Ga0097621_100245733
268 Ga0068871_100045869
269 Ga0068871_100125859
270 Ga0068871_100370354
271 Ga0068871_100418454
272 Ga0075431_100504321
273 Ga0075434_100005632
274 Ga0075434_100025941
275 Ga0075436_100083679
276 Ga0075436_100342762
277 Ga0097620_100102130
278 Ga0075435_100032165
279 Ga0111539_10098018
280 Ga0111539_10706606
281 Ga0114129_10032448
282 Ga0114129_10044388
283 Ga0114129_10073152
284 Ga0114129_11841247
285 Ga0105242_10081396
286 Ga0105248_10015114
287 Ga0105248_11497318
288 Ga0105249_11804592
289 Ga0105246_10026699
290 Ga0157374_10448405
291 Ga0157378_11856077
292 Ga0163162_10011703
293 Ga0157372_10124258
294 Ga0157375_10001506
295 Ga0157375_10203730
296 Ga0157375_10723097
297 Ga0163163_10025019
298 Ga0163163_10031572
299 Ga0163163_10388556
300 Ga0163163_11717270
301 Ga0157377_10480822
302 Ga0157379_10043783
303 Ga0157376_10063107
304 Ga0163161_10122102
305 Ga0163161_11431847
306 Ga0207680_10006049
307 Ga0207649_10008176
308 Ga0207646_10018574
309 Ga0207650_10006302
310 Ga0207650_10431442
311 Ga0207659_10524427
312 Ga0207670_10174435
313 Ga0207691_10117625
314 Ga0207661_10203706
315 Ga0207679_10003716
316 Ga0207651_10011752
317 Ga0207651_10113238
318 Ga0207658_10005751
319 Ga0207677_10005084
320 Ga0207677_10709996
321 Ga0207703_10021065
322 Ga0207703_10080098
323 Ga0207708_10693245
324 Ga0207641_10049008
325 Ga0207641_10138797
326 Ga0207648_10083192
327 Ga0207676_10000283
328 Ga0207683_10413898
329 Ga0265319_1016435
330 Ga0265334_10011288
331 Ga0265338_10009532
332 Ga0265313_10074444
333 Ga0316575_10004901
334 Ga0316575_10034455
335 Ga0316579_10000832
336 Ga0316576_10067834
337 Ga0316576_10109534
338 Ga0316578_10015990
339 Ga0316578_10143098
340 Ga0316577_10024227
341 Ga0316577_10212582
342 Ga0316583_10000732
343 Ga0316585_10000930
344 Ga0316585_10068264
345 Ga0316585_10090635
346 Ga0316585_10136832
347 Ga0316585_10328262
348 Ga0316580_10000571
349 Ga0316593_10017799
350 Ga0316593_10038719
351 Ga0316593_10045114
352 Ga0316593_10120045
353 Ga0316593_10391390
354 Ga0316592_1057463
355 Ga0316596_1015987
356 Ga0316596_1033058
357 Ga0373923_0038417
358 Ga0373923_0346481
359 Ga0373939_0078287
360 Ga0373954_0261601
361 Ga0373943_0096649
362 Ga0373955_0582324
363 Ga0373955_0626413
364 Ga0373962_0149220
365 Ga0316574_0010258
366 Ga0316574_0045189
367 Ga0316574_0088794
368 Ga0373924_0083443
369 Ga0373931_0079934
370 Ga0373933_0755419
371 Ga0373933_0806596
372 Ga0373937_0035578
373 Ga0373937_0052627
374 Ga0373937_0070075
375 Ga0373937_0110124
376 Ga0373937_0467982
377 Ga0316582_0008555
378 Ga0316582_0011568
379 Ga0316582_0035735
380 Ga0316582_0057799
381 Ga0316582_0111522
382 Ga0316582_0249471
383 Ga0316582_0257013
384 Ga0316582_0732979
385 Ga0316584_0015347
386 Ga0316584_0020856
387 Ga0316584_0028328
388 Ga0316584_0179069
389 Ga0316584_0297826
390 Ga0316584_0448989
391 Ga0316584_1070037
392 Ga0395905_0015175
393 Ga0316581_0141812
394 Ga0436361_0722658
395 Ga0436362_0446138
396 Ga0451839_1262373
397 Ga0451577_0740486
398 Ga0453683_0303895
399 Ga0453684_0336408
400 Ga0451576_0020554
401 Ga0495592_0035520
402 Ga0495651_0932128
403 Ga0495580_0951883
404 Ga0495618_0227811
405 Ga0495618_0350750
406 Ga0495630_1068827
407 Ga0495586_0161725
408 Ga0495645_0510940
409 Ga0495667_0004067
410 Ga0495657_0006300
411 Ga0495613_0045762
412 Ga0495613_0059401
413 Ga0495600_0157496
414 Ga0495581_0030450
415 Ga0495581_0217244
416 Ga0495675_0227601
417 Ga0496109_1586125
418 Ga0496110_1738865
419 Ga0496115_0502741
420 Ga0501034_0052929
421 Ga0501071_0796386
422 Ga0501080_1137236
423 Ga0501035_1032872
424 Ga0501044_0093787
425 nmdc:mga05p37_1524470_c1
426 nmdc:mga05p37_172735_c1
427 nmdc:mga05p37_383402_c1
428 nmdc:mga05p37_794908_c1
429 nmdc:mga0n895_176199_c1
430 nmdc:mga0n895_7257_c1
431 nmdc:mga0rr50_24392_c1
432 nmdc:mga0rr50_45092_c1
433 nmdc:mga0a205_1462703_c1
434 nmdc:mga0a205_73493_c1
435 Ga0495601_0149498
436 Ga0495601_0634681
437 Ga0495619_0127664
438 Ga0530510_1475335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

138

0.92

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

127

0.76

PF18029

Glyoxalase_6

Glyoxalase-like domain

17

139

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
7n7g-assembly1.cif.gz_B crystal structure of fosb from enterococcus faecium with fosfomycin 0.8521 3 122
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.8478 5 122
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.8424 5 121
1lqo-assembly1.cif.gz_B crystal strutcure of the fosfomycin resistance protein a (fosa) containing bound thallium cations 0.8409 3 122
3r4q-assembly2.cif.gz_D crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.8311 1 125
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9014 68 122 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8766 65 120 3.30.720.110
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8669 5 122 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8566 6 121 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8459 5 122 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V9M4G9-F1-model_v4 Glyoxalase 0.9652 66 129
AF-A0A534TE14-F1-model_v4 VOC family protein 0.961 5 125 GO:0004462
GO:0004493
GO:0046491
GO:0046872
AF-A0A2V9M4G9-F1-model_v4 Glyoxalase 0.9507 66 129
AF-A0A0T5ZAA1-F1-model_v4 Glyoxalase-like domain (Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein) 0.9468 1 127 GO:0051213
AF-A0Y821-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9405 6 126 GO:0051213

Map