F331140

General Info

Members Datasets Scaffolds Average Seq Length
219 127 438 214

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10095461|Ga0213876_100954612
Length 250
Sequence VHPLAVTRWQSRLPEPSGNGKLTEYLQFGRAVLRQFLPVATDLIQISCESPDNTAIERAVREVRKGGVVGVPTDALYVLVADPFNLAAVGRVFAAKGRESIRSLPLAVSDTLMAEDLAKELSSRFYILARHFWPGPLTMIVPAAAKVPLKVTGNTGRLAMRHANSNPLNLMVEKIGHALIATSANRSGEPTLSSGIELFAQMDGQLNLVLDGGLCTGPGSTTVDITEPYWRVIKEGAVSEKDIAERLQAT

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.83
Rhizosphere 77.63
Stem 0
Stem Tuber 0
Unclassified 25.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10095461 3300021384 Bacteria 1575
2 Ga0070683_100307019 3300005329 Bacteria 1509
3 Ga0070680_100091219 3300005336 Bacteria 2522
4 Ga0070660_100134062 3300005339 Bacteria 1984
5 Ga0070689_100079628 3300005340 Bacteria 2570
6 Ga0070661_100239772 3300005344 Bacteria 1396
7 Ga0070659_100576253 3300005366 Unclassified 965
8 Ga0070709_10576101 3300005434 Unclassified 864
9 Ga0070714_100000888 3300005435 Bacteria 21188
10 Ga0070714_100490797 3300005435 Unclassified 1170
11 Ga0070713_100001552 3300005436 Bacteria 14693
12 Ga0070713_100177136 3300005436 Unclassified 1914
13 Ga0070713_100200464 3300005436 Bacteria 1802
14 Ga0070713_100256102 3300005436 Bacteria 1598
15 Ga0070711_100016840 3300005439 Bacteria 4646
16 Ga0070711_100162560 3300005439 Bacteria 1694
17 Ga0070663_100012859 3300005455 Bacteria 5312
18 Ga0070681_10041909 3300005458 Bacteria 4589
19 Ga0070681_10623274 3300005458 Bacteria 993
20 Ga0070679_100241124 3300005530 Unclassified 1765
21 Ga0070679_100257424 3300005530 Bacteria 1701
22 Ga0070684_101056167 3300005535 Bacteria 763
23 Ga0070665_100053017 3300005548 Bacteria 4068
24 Ga0068855_100006182 3300005563 Bacteria 14597
25 Ga0068855_100186871 3300005563 Unclassified 2340
26 Ga0070664_100262888 3300005564 Bacteria 1553
27 Ga0068857_100198957 3300005577 Bacteria 1826
28 Ga0068854_100516354 3300005578 Unclassified 1008
29 Ga0068856_100012433 3300005614 Bacteria 8241
30 Ga0068856_100172526 3300005614 Bacteria 2175
31 Ga0068856_100191494 3300005614 Bacteria 2059
32 Ga0068852_100338890 3300005616 Bacteria 1465
33 Ga0068859_100066016 3300005617 Unclassified 3653
34 Ga0068858_100078163 3300005842 Unclassified 3075
35 Ga0081455_10024231 3300005937 Bacteria 5625
36 Ga0070717_10053374 3300006028 Unclassified 3332
37 Ga0070717_10307653 3300006028 Unclassified 1410
38 Ga0070717_10356427 3300006028 Bacteria 1308
39 Ga0097621_100098925 3300006237 Bacteria 2451
40 Ga0097621_100349466 3300006237 Unclassified 1315
41 Ga0068871_100137558 3300006358 Bacteria 2075
42 Ga0097620_100066016 3300006931 Unclassified 3653
43 Ga0105240_10006036 3300009093 Bacteria 17911
44 Ga0105240_10025245 3300009093 Bacteria 7813
45 Ga0105240_10042678 3300009093 Bacteria 5778
46 Ga0105240_10072808 3300009093 Bacteria 4246
47 Ga0105240_10376480 3300009093 Bacteria 1604
48 Ga0105240_10770840 3300009093 Unclassified 1044
49 Ga0105247_10119424 3300009101 Bacteria 1706
50 Ga0105242_10061144 3300009176 Bacteria 3097
51 Ga0105248_10021161 3300009177 Bacteria 7206
52 Ga0105248_10114412 3300009177 Bacteria 3043
53 Ga0105237_10002963 3300009545 Bacteria 20548
54 Ga0105237_10282163 3300009545 Unclassified 1663
55 Ga0105237_10728637 3300009545 Bacteria 998
56 Ga0105249_10257724 3300009553 Bacteria 1732
57 Ga0157373_10222237 3300013100 Bacteria 1332
58 Ga0157373_10244691 3300013100 Bacteria 1268
59 Ga0157370_10303854 3300013104 Bacteria 1473
60 Ga0157369_10007948 3300013105 Bacteria 12191
61 Ga0157369_10018564 3300013105 Bacteria 7795
62 Ga0157369_10312134 3300013105 Bacteria 1635
63 Ga0157374_10032750 3300013296 Bacteria 4736
64 Ga0157374_10131949 3300013296 Unclassified 2418
65 Ga0163162_10324877 3300013306 Bacteria 1671
66 Ga0157375_11277200 3300013308 Unclassified 862
67 Ga0163163_10058159 3300014325 Bacteria 3822
68 Ga0157379_10047411 3300014968 Bacteria 3834
69 Ga0157376_11063917 3300014969 Bacteria 834
70 Ga0213873_10002164 3300021358 Unclassified 3369
71 Ga0213874_10007807 3300021377 Bacteria 2583
72 Ga0213874_10016753 3300021377 Bacteria 1956
73 Ga0213876_10001101 3300021384 Bacteria 17298
74 Ga0213876_10004425 3300021384 Bacteria 7881
75 Ga0213876_10240531 3300021384 Unclassified 962
76 Ga0213876_10248892 3300021384 Unclassified 944
77 Ga0213875_10000112 3300021388 Bacteria 91961
78 Ga0213875_10001118 3300021388 Bacteria 18531
79 Ga0213875_10002152 3300021388 Bacteria 12023
80 Ga0213875_10024099 3300021388 Bacteria 2903
81 Ga0207699_10586526 3300025906 Unclassified 811
82 Ga0207654_10330867 3300025911 Bacteria 1044
83 Ga0207707_10101730 3300025912 Bacteria 2512
84 Ga0207695_10004872 3300025913 Bacteria 18104
85 Ga0207695_10039993 3300025913 Bacteria 5034
86 Ga0207695_10057121 3300025913 Bacteria 4057
87 Ga0207671_10154153 3300025914 Unclassified 1776
88 Ga0207693_10298359 3300025915 Unclassified 1262
89 Ga0207663_10031442 3300025916 Bacteria 3142
90 Ga0207663_10071373 3300025916 Bacteria 2241
91 Ga0207663_10172745 3300025916 Bacteria 1536
92 Ga0207660_10285525 3300025917 Bacteria 1311
93 Ga0207657_10042134 3300025919 Unclassified 4030
94 Ga0207657_10351769 3300025919 Unclassified 1162
95 Ga0207657_10859891 3300025919 Unclassified 700
96 Ga0207652_10122692 3300025921 Bacteria 2312
97 Ga0207694_10039682 3300025924 Bacteria 3623
98 Ga0207694_10063877 3300025924 Bacteria 2868
99 Ga0207687_10123040 3300025927 Bacteria 1943
100 Ga0207700_10001501 3300025928 Bacteria 13209
101 Ga0207700_10234840 3300025928 Bacteria 1561
102 Ga0207664_10009192 3300025929 Bacteria 6925
103 Ga0207664_10433476 3300025929 Unclassified 1172
104 Ga0207670_10071128 3300025936 Bacteria 2405
105 Ga0207711_10016219 3300025941 Bacteria 6186
106 Ga0207667_10047437 3300025949 Bacteria 4547
107 Ga0207640_10504532 3300025981 Unclassified 1008
108 Ga0207703_10118263 3300026035 Unclassified 2271
109 Ga0207678_10011625 3300026067 Bacteria 7733
110 Ga0207678_10292679 3300026067 Bacteria 1399
111 Ga0207702_10016364 3300026078 Bacteria 6140
112 Ga0207702_10046897 3300026078 Bacteria 3639
113 Ga0207702_10090862 3300026078 Unclassified 2672
114 Ga0207641_10150740 3300026088 Bacteria 2106
115 Ga0207698_10354484 3300026142 Unclassified 1387
116 Ga0268266_10304394 3300028379 Bacteria 1488
117 Ga0268264_10719940 3300028381 Bacteria 992
118 Ga0265760_10111125 3300031090 Bacteria 873
119 Ga0373936_0108514 3300035113 Bacteria 1177
120 Ga0373957_0055267 3300035120 Unclassified 1526
121 Ga0373943_0168014 3300035170 Bacteria 1198
122 Ga0373927_0004621 3300035695 Bacteria 9599
123 Ga0373927_0018681 3300035695 Bacteria 4550
124 Ga0373933_0121800 3300035724 Unclassified 1634
125 Ga0373947_0006705 3300035725 Bacteria 6679
126 Ga0373947_0440917 3300035725 Unclassified 881
127 Ga0373925_0000179 3300037068 Bacteria 69286
128 Ga0373925_0750768 3300037068 Unclassified 804
129 Ga0436364_0092189 3300037853 Bacteria 899
130 Ga0436364_0105323 3300037853 Unclassified 3180
131 Ga0436364_0237611 3300037853 Bacteria 3629
132 Ga0436364_0247627 3300037853 Unclassified 4730
133 Ga0436364_0258796 3300037853 Bacteria 11544
134 Ga0436364_0258884 3300037853 Bacteria 4215
135 Ga0436364_0273611 3300037853 Bacteria 55309
136 Ga0436364_0285932 3300037853 Bacteria 7659
137 Ga0436364_0325042 3300037853 Bacteria 4793
138 Ga0436364_0517360 3300037853 Bacteria 13526
139 Ga0436364_0570061 3300037853 Bacteria 2176
140 Ga0436364_0579539 3300037853 Bacteria 71293
141 Ga0436364_0749502 3300037853 Bacteria 105484
142 Ga0436364_0795326 3300037853 Bacteria 4490
143 Ga0436364_0827984 3300037853 Unclassified 1690
144 Ga0436364_0922728 3300037853 Bacteria 6818
145 Ga0436364_1258217 3300037853 Bacteria 1320
146 Ga0436364_1389969 3300037853 Bacteria 2632
147 Ga0436364_1392178 3300037853 Unclassified 1756
148 Ga0436364_1525075 3300037853 Bacteria 6676
149 Ga0395901_0097725 3300038443 Bacteria 3079
150 Ga0436365_0041310 3300039437 Bacteria 28215
151 Ga0436365_0204215 3300039437 Bacteria 2507
152 Ga0436365_0668850 3300039437 Unclassified 977
153 Ga0436365_0929214 3300039437 Bacteria 4071
154 Ga0436365_1010213 3300039437 Bacteria 1037
155 Ga0436365_1345064 3300039437 Bacteria 8764
156 Ga0436365_1733968 3300039437 Unclassified 1385
157 Ga0436365_1750911 3300039437 Bacteria 4116
158 Ga0436365_1931188 3300039437 Unclassified 2014
159 Ga0436360_0133817 3300039438 Bacteria 3170
160 Ga0436360_0864090 3300039438 Bacteria 2085
161 Ga0436361_0031356 3300039447 Unclassified 1384
162 Ga0436361_0053984 3300039447 Bacteria 1304
163 Ga0436363_0748797 3300039450 Bacteria 2184
164 Ga0436363_1129815 3300039450 Bacteria 2643
165 Ga0436363_1641292 3300039450 Bacteria 740
166 Ga0436363_1709463 3300039450 Bacteria 1932
167 Ga0436362_0060667 3300039453 Bacteria 1432
168 Ga0436362_0528551 3300039453 Bacteria 3882
169 Ga0466963_0244081 3300044694 Unclassified 1260
170 Ga0466957_0324353 3300044842 Unclassified 1040
171 Ga0466959_0273864 3300045049 Unclassified 1160
172 Ga0466958_0310926 3300045836 Unclassified 1012
173 Ga0466967_0585588 3300045976 Bacteria 1100
174 Ga0495580_0199633 3300046472 Unclassified 1378
175 Ga0495608_0155306 3300046511 Bacteria 1457
176 Ga0495667_0521768 3300046559 Bacteria 743
177 Ga0495674_0543971 3300047319 Unclassified 925
178 Ga0496110_0466463 3300048913 Bacteria 1151
179 Ga0496112_0089746 3300048915 Bacteria 3042
180 Ga0496115_0010157 3300048918 Bacteria 7024
181 Ga0496115_0561053 3300048918 Unclassified 912
182 Ga0496126_0162209 3300048929 Bacteria 1909
183 Ga0501031_0169320 3300049568 Bacteria 1427
184 Ga0501032_0004512 3300049569 Bacteria 10477
185 Ga0501032_0103430 3300049569 Bacteria 1887
186 Ga0501033_0004613 3300049570 Bacteria 11032
187 Ga0501033_0116457 3300049570 Unclassified 1942
188 Ga0501034_0023120 3300049571 Bacteria 6335
189 Ga0501034_0055543 3300049571 Bacteria 3984
190 Ga0501036_0000169 3300049572 Bacteria 43136
191 Ga0501037_0010058 3300049573 Bacteria 6939
192 Ga0501038_0002204 3300049574 Bacteria 18117
193 Ga0501043_0003790 3300049579 Bacteria 12424
194 Ga0501046_0002817 3300049580 Bacteria 16196
195 Ga0501046_0229022 3300049580 Unclassified 1374
196 Ga0501047_0016197 3300049581 Bacteria 7113
197 Ga0501047_0517517 3300049581 Unclassified 1019
198 Ga0501067_0003565 3300049583 Bacteria 8569
199 Ga0501068_0005161 3300049584 Bacteria 7120
200 Ga0501069_0001178 3300049585 Bacteria 12696
201 Ga0501070_0016705 3300049586 Bacteria 6164
202 Ga0501072_0000228 3300049588 Bacteria 41400
203 Ga0501073_0011395 3300049589 Bacteria 6505
204 Ga0501073_0161760 3300049589 Unclassified 1551
205 Ga0501074_0053797 3300049590 Bacteria 2903
206 Ga0501075_0681785 3300049591 Bacteria 783
207 Ga0501076_0047133 3300049592 Bacteria 3407
208 Ga0501077_0028626 3300049593 Bacteria 3541
209 Ga0501079_0128881 3300049741 Bacteria 1968
210 Ga0501080_0004398 3300049742 Bacteria 12521
211 Ga0501035_0153579 3300049822 Unclassified 1996
212 Ga0501035_0882518 3300049822 Unclassified 709
213 Ga0501044_0000656 3300049823 Bacteria 41851
214 Ga0501044_0005452 3300049823 Bacteria 14136
215 Ga0501044_0049096 3300049823 Bacteria 4356
216 Ga0501044_0423768 3300049823 Bacteria 1240
217 nmdc:mga0qj67_99054_c1 3300050509 Bacteria 2348
218 Ga0501084_0092592 3300054114 Bacteria 2537
219 Ga0501082_0153505 3300060353 Bacteria 2000
220 Ga0213876_10095461
221 Ga0070683_100307019
222 Ga0070680_100091219
223 Ga0070660_100134062
224 Ga0070689_100079628
225 Ga0070661_100239772
226 Ga0070659_100576253
227 Ga0070709_10576101
228 Ga0070714_100000888
229 Ga0070714_100490797
230 Ga0070713_100001552
231 Ga0070713_100177136
232 Ga0070713_100200464
233 Ga0070713_100256102
234 Ga0070711_100016840
235 Ga0070711_100162560
236 Ga0070663_100012859
237 Ga0070681_10041909
238 Ga0070681_10623274
239 Ga0070679_100241124
240 Ga0070679_100257424
241 Ga0070684_101056167
242 Ga0070665_100053017
243 Ga0068855_100006182
244 Ga0068855_100186871
245 Ga0070664_100262888
246 Ga0068857_100198957
247 Ga0068854_100516354
248 Ga0068856_100012433
249 Ga0068856_100172526
250 Ga0068856_100191494
251 Ga0068852_100338890
252 Ga0068859_100066016
253 Ga0068858_100078163
254 Ga0081455_10024231
255 Ga0070717_10053374
256 Ga0070717_10307653
257 Ga0070717_10356427
258 Ga0097621_100098925
259 Ga0097621_100349466
260 Ga0068871_100137558
261 Ga0097620_100066016
262 Ga0105240_10006036
263 Ga0105240_10025245
264 Ga0105240_10042678
265 Ga0105240_10072808
266 Ga0105240_10376480
267 Ga0105240_10770840
268 Ga0105247_10119424
269 Ga0105242_10061144
270 Ga0105248_10021161
271 Ga0105248_10114412
272 Ga0105237_10002963
273 Ga0105237_10282163
274 Ga0105237_10728637
275 Ga0105249_10257724
276 Ga0157373_10222237
277 Ga0157373_10244691
278 Ga0157370_10303854
279 Ga0157369_10007948
280 Ga0157369_10018564
281 Ga0157369_10312134
282 Ga0157374_10032750
283 Ga0157374_10131949
284 Ga0163162_10324877
285 Ga0157375_11277200
286 Ga0163163_10058159
287 Ga0157379_10047411
288 Ga0157376_11063917
289 Ga0213873_10002164
290 Ga0213874_10007807
291 Ga0213874_10016753
292 Ga0213876_10001101
293 Ga0213876_10004425
294 Ga0213876_10240531
295 Ga0213876_10248892
296 Ga0213875_10000112
297 Ga0213875_10001118
298 Ga0213875_10002152
299 Ga0213875_10024099
300 Ga0207699_10586526
301 Ga0207654_10330867
302 Ga0207707_10101730
303 Ga0207695_10004872
304 Ga0207695_10039993
305 Ga0207695_10057121
306 Ga0207671_10154153
307 Ga0207693_10298359
308 Ga0207663_10031442
309 Ga0207663_10071373
310 Ga0207663_10172745
311 Ga0207660_10285525
312 Ga0207657_10042134
313 Ga0207657_10351769
314 Ga0207657_10859891
315 Ga0207652_10122692
316 Ga0207694_10039682
317 Ga0207694_10063877
318 Ga0207687_10123040
319 Ga0207700_10001501
320 Ga0207700_10234840
321 Ga0207664_10009192
322 Ga0207664_10433476
323 Ga0207670_10071128
324 Ga0207711_10016219
325 Ga0207667_10047437
326 Ga0207640_10504532
327 Ga0207703_10118263
328 Ga0207678_10011625
329 Ga0207678_10292679
330 Ga0207702_10016364
331 Ga0207702_10046897
332 Ga0207702_10090862
333 Ga0207641_10150740
334 Ga0207698_10354484
335 Ga0268266_10304394
336 Ga0268264_10719940
337 Ga0265760_10111125
338 Ga0373936_0108514
339 Ga0373957_0055267
340 Ga0373943_0168014
341 Ga0373927_0004621
342 Ga0373927_0018681
343 Ga0373933_0121800
344 Ga0373947_0006705
345 Ga0373947_0440917
346 Ga0373925_0000179
347 Ga0373925_0750768
348 Ga0436364_0092189
349 Ga0436364_0105323
350 Ga0436364_0237611
351 Ga0436364_0247627
352 Ga0436364_0258796
353 Ga0436364_0258884
354 Ga0436364_0273611
355 Ga0436364_0285932
356 Ga0436364_0325042
357 Ga0436364_0517360
358 Ga0436364_0570061
359 Ga0436364_0579539
360 Ga0436364_0749502
361 Ga0436364_0795326
362 Ga0436364_0827984
363 Ga0436364_0922728
364 Ga0436364_1258217
365 Ga0436364_1389969
366 Ga0436364_1392178
367 Ga0436364_1525075
368 Ga0395901_0097725
369 Ga0436365_0041310
370 Ga0436365_0204215
371 Ga0436365_0668850
372 Ga0436365_0929214
373 Ga0436365_1010213
374 Ga0436365_1345064
375 Ga0436365_1733968
376 Ga0436365_1750911
377 Ga0436365_1931188
378 Ga0436360_0133817
379 Ga0436360_0864090
380 Ga0436361_0031356
381 Ga0436361_0053984
382 Ga0436363_0748797
383 Ga0436363_1129815
384 Ga0436363_1641292
385 Ga0436363_1709463
386 Ga0436362_0060667
387 Ga0436362_0528551
388 Ga0466963_0244081
389 Ga0466957_0324353
390 Ga0466959_0273864
391 Ga0466958_0310926
392 Ga0466967_0585588
393 Ga0495580_0199633
394 Ga0495608_0155306
395 Ga0495667_0521768
396 Ga0495674_0543971
397 Ga0496110_0466463
398 Ga0496112_0089746
399 Ga0496115_0010157
400 Ga0496115_0561053
401 Ga0496126_0162209
402 Ga0501031_0169320
403 Ga0501032_0004512
404 Ga0501032_0103430
405 Ga0501033_0004613
406 Ga0501033_0116457
407 Ga0501034_0023120
408 Ga0501034_0055543
409 Ga0501036_0000169
410 Ga0501037_0010058
411 Ga0501038_0002204
412 Ga0501043_0003790
413 Ga0501046_0002817
414 Ga0501046_0229022
415 Ga0501047_0016197
416 Ga0501047_0517517
417 Ga0501067_0003565
418 Ga0501068_0005161
419 Ga0501069_0001178
420 Ga0501070_0016705
421 Ga0501072_0000228
422 Ga0501073_0011395
423 Ga0501073_0161760
424 Ga0501074_0053797
425 Ga0501075_0681785
426 Ga0501076_0047133
427 Ga0501077_0028626
428 Ga0501079_0128881
429 Ga0501080_0004398
430 Ga0501035_0153579
431 Ga0501035_0882518
432 Ga0501044_0000656
433 Ga0501044_0005452
434 Ga0501044_0049096
435 Ga0501044_0423768
436 nmdc:mga0qj67_99054_c1
437 Ga0501084_0092592
438 Ga0501082_0153505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

61

236

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.7391 3 176
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.7299 3 177
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.6832 3 207
1hru-assembly1.cif.gz_B the structure of the yrdc gene product from e.coli 0.676 16 181
3vth-assembly2.cif.gz_B crystal structure of full-length hypf in the phosphate- and nucleotide-bound form 0.6601 18 179
ID Description Score Start End Superfamily
3vthB01 Alpha Beta;Alpha-Beta Complex;DHBP synthase; 0.8218 18 173 3.90.870.30
3ttfA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase; 0.8028 12 176 3.90.870.30
3vthA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase; 0.7822 12 176 3.90.870.50
4e1bA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.732 3 181 3.90.870.10
af_F1QWR2_601_815_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.7241 14 180 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A2G6LTM2-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.7631 1 191 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A7V8E2E7-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.756 3 180 GO:0000049
GO:0003725
GO:0004725
GO:0005737
GO:0006450
GO:0008033
GO:0016779
AF-A0A1V5QYS9-F1-model_v4 Threonylcarbamoyl-AMP synthase (EC 2.7.7.87) 0.7478 5 179 GO:0003725
GO:0061710
AF-A0A2E8HNT6-F1-model_v4 Threonylcarbamoyl-AMP synthase 0.7463 1 176 GO:0003725
AF-A0A7Y2CMM1-F1-model_v4 L-threonylcarbamoyladenylate synthase (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) 0.7454 1 178 GO:0000049
GO:0003725
GO:0005737
GO:0006450
GO:0008033
GO:0016779

Map