F331031

General Info

Members Datasets Scaffolds Average Seq Length
219 107 438 268

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10206491|Ga0114129_102064913
Length 295
Sequence VDAFPLPGSAPATVAASPPGLGEGFWAGSSSAALDEDGTFVIAYRVRNGHAGRGSTVVARSEDGERLTPVAHLDQRRFQADSMERPAIVRTDEGRWRLYVCCATPAPSKHWWIDVLEGDDPADFGSAETRTVFPGNEHTGVKDPIVQRAADGGWQAWICCHPLDEKDEEDRMTTAYATSEDGLEWEWHGTVLEPRPGTWDERGTRLTAILPDGRAAYDGRATKEQNFFERTGLARRNHGGRFEQTNTAPAYDARYLDVLPLPGGGYRIWYEARLPDESHELRTELIGKISDGSPV

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
22 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
23 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
29 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
30 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
31 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
32 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
33 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
34 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
40 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
43 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
46 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
47 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
48 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
49 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
50 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
51 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
52 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
53 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
54 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
55 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
56 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
57 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
58 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
59 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
60 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
64 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
65 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
68 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
72 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
92 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
93 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
94 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
104 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
105 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 8.22
Rhizosphere 87.21
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10206491 3300009147 Archaea 2657
2 rootL2_10288739 3300003322 Bacteria 1713
3 JGI25407J50210_10004335 3300003373 Bacteria 3447
4 Ga0070668_100035938 3300005347 Bacteria 3780
5 Ga0070714_100075951 3300005435 Bacteria 2916
6 Ga0070713_100051010 3300005436 Bacteria 3421
7 Ga0070713_100087542 3300005436 Bacteria 2672
8 Ga0068856_100386595 3300005614 Bacteria 1419
9 Ga0068861_100156320 3300005719 Bacteria 1876
10 Ga0081455_10061019 3300005937 Bacteria 3175
11 Ga0081538_10004863 3300005981 Bacteria 12235
12 Ga0081538_10008325 3300005981 Bacteria 8829
13 Ga0081538_10008993 3300005981 Bacteria 8391
14 Ga0081538_10018115 3300005981 Bacteria 5309
15 Ga0081538_10033320 3300005981 Bacteria 3432
16 Ga0081539_10002898 3300005985 Bacteria 22717
17 Ga0081539_10005315 3300005985 Bacteria 13242
18 Ga0081539_10014372 3300005985 Bacteria 5861
19 Ga0081539_10025465 3300005985 Bacteria 3809
20 Ga0081539_10049512 3300005985 Bacteria 2384
21 Ga0070717_10028955 3300006028 Bacteria 4438
22 Ga0070717_10194147 3300006028 Bacteria 1775
23 Ga0070717_10240230 3300006028 Unclassified 1597
24 Ga0070717_10271313 3300006028 Bacteria 1503
25 Ga0075365_10003104 3300006038 Bacteria 8448
26 Ga0070712_100041697 3300006175 Bacteria 3152
27 Ga0075436_100007629 3300006914 Bacteria 7393
28 Ga0075436_100201645 3300006914 Unclassified 1409
29 Ga0111539_10131710 3300009094 Bacteria 2928
30 Ga0114129_10007775 3300009147 Bacteria 15253
31 Ga0114129_10191460 3300009147 Bacteria 2777
32 Ga0114129_10955580 3300009147 Unclassified 1082
33 Ga0105249_10142568 3300009553 Bacteria 2299
34 Ga0157369_10009201 3300013105 Bacteria 11302
35 Ga0163162_10224340 3300013306 Bacteria 2009
36 Ga0157372_10392755 3300013307 Unclassified 1617
37 Ga0213876_10005271 3300021384 Bacteria 7120
38 Ga0213875_10036716 3300021388 Bacteria 2310
39 Ga0207693_10005577 3300025915 Bacteria 10471
40 Ga0207693_10098533 3300025915 Bacteria 2292
41 Ga0207687_10231797 3300025927 Bacteria 1459
42 Ga0207702_10166400 3300026078 Bacteria 2018
43 Ga0207702_10645627 3300026078 Bacteria 1041
44 Ga0207675_100005816 3300026118 Bacteria 11783
45 Ga0207698_10147458 3300026142 Bacteria 2037
46 Ga0307408_100012883 3300031548 Bacteria 5543
47 Ga0307405_10014617 3300031731 Bacteria 4227
48 Ga0307405_10023921 3300031731 Bacteria 3481
49 Ga0307413_10010302 3300031824 Bacteria 4525
50 Ga0307413_10118622 3300031824 Bacteria 1787
51 Ga0307410_10021510 3300031852 Bacteria 3969
52 Ga0307410_10022822 3300031852 Bacteria 3876
53 Ga0307410_10057757 3300031852 Bacteria 2643
54 Ga0307410_10063525 3300031852 Bacteria 2533
55 Ga0307406_10123636 3300031901 Bacteria 1803
56 Ga0307406_10127687 3300031901 Bacteria 1779
57 Ga0307406_10186332 3300031901 Bacteria 1515
58 Ga0307407_10001201 3300031903 Bacteria 9164
59 Ga0307407_10026953 3300031903 Bacteria 3051
60 Ga0307412_10160125 3300031911 Bacteria 1671
61 Ga0307409_100003927 3300031995 Bacteria 8231
62 Ga0307409_100005376 3300031995 Bacteria 7357
63 Ga0307409_100013993 3300031995 Bacteria 5194
64 Ga0307409_100041811 3300031995 Bacteria 3427
65 Ga0307416_100001334 3300032002 Bacteria 13291
66 Ga0307416_100013202 3300032002 Bacteria 5605
67 Ga0307416_100053737 3300032002 Bacteria 3233
68 Ga0307416_100070365 3300032002 Bacteria 2901
69 Ga0307416_100104850 3300032002 Bacteria 2473
70 Ga0307416_100236401 3300032002 Bacteria 1766
71 Ga0307411_10050268 3300032005 Bacteria 2714
72 Ga0307415_100006496 3300032126 Bacteria 6315
73 Ga0307415_100007344 3300032126 Bacteria 6022
74 Ga0307415_100011202 3300032126 Bacteria 5119
75 Ga0307415_100025869 3300032126 Bacteria 3692
76 Ga0307415_100432232 3300032126 Unclassified 1133
77 Ga0395899_0049216 3300037312 Bacteria 3134
78 Ga0395899_0134911 3300037312 Unclassified 1760
79 Ga0395899_0312996 3300037312 Unclassified 1060
80 Ga0395900_0001291 3300037418 Bacteria 30553
81 Ga0395900_0003136 3300037418 Bacteria 17929
82 Ga0395900_0004208 3300037418 Bacteria 15271
83 Ga0395900_0031744 3300037418 Bacteria 5429
84 Ga0395900_0036552 3300037418 Bacteria 5063
85 Ga0395900_0039615 3300037418 Bacteria 4855
86 Ga0395900_0059917 3300037418 Unclassified 3918
87 Ga0395900_0069357 3300037418 Bacteria 3623
88 Ga0395900_0078518 3300037418 Bacteria 3391
89 Ga0395900_0167138 3300037418 Bacteria 2241
90 Ga0395898_0007590 3300037466 Bacteria 11515
91 Ga0395898_0015020 3300037466 Bacteria 7948
92 Ga0395898_0038057 3300037466 Bacteria 4770
93 Ga0395898_0064538 3300037466 Unclassified 3551
94 Ga0395898_0395550 3300037466 Bacteria 1318
95 Ga0395898_0557943 3300037466 Bacteria 1088
96 Ga0395905_0004895 3300037471 Bacteria 13800
97 Ga0395905_0010536 3300037471 Bacteria 8979
98 Ga0395905_0041224 3300037471 Bacteria 4333
99 Ga0395905_0049807 3300037471 Bacteria 3926
100 Ga0395905_0111453 3300037471 Bacteria 2569
101 Ga0395905_0121645 3300037471 Bacteria 2454
102 Ga0436364_0721738 3300037853 Bacteria 23921
103 Ga0395901_0000365 3300038443 Bacteria 54535
104 Ga0395901_0000733 3300038443 Bacteria 37083
105 Ga0395901_0006375 3300038443 Bacteria 11955
106 Ga0395901_0006872 3300038443 Bacteria 11494
107 Ga0395901_0079355 3300038443 Bacteria 3427
108 Ga0395901_0127326 3300038443 Bacteria 2676
109 Ga0395901_0166370 3300038443 Bacteria 2315
110 Ga0395901_0192362 3300038443 Bacteria 2139
111 Ga0436365_0929639 3300039437 Bacteria 14289
112 Ga0436365_1027412 3300039437 Bacteria 7088
113 Ga0436363_0245746 3300039450 Bacteria 5552
114 Ga0436363_0897861 3300039450 Bacteria 3223
115 Ga0436363_0925378 3300039450 Bacteria 8610
116 Ga0439448_0000530 3300042005 Bacteria 8886
117 Ga0439448_0028325 3300042005 Bacteria 1769
118 Ga0439450_000277 3300042008 Bacteria 6274
119 Ga0439454_002358 3300042011 Bacteria 1978
120 Ga0439455_0000540 3300042012 Bacteria 5322
121 Ga0439455_0040080 3300042012 Bacteria 1197
122 Ga0439463_001090 3300042016 Bacteria 7327
123 Ga0439463_012174 3300042016 Bacteria 2113
124 Ga0450900_013020 3300042136 Bacteria 1095
125 Ga0450902_019910 3300042137 Bacteria 1105
126 Ga0450889_003301 3300042144 Bacteria 1593
127 Ga0450910_007482 3300042147 Bacteria 1524
128 Ga0439444_0005907 3300042437 Bacteria 1829
129 Ga0439444_0006538 3300042437 Bacteria 1764
130 Ga0439464_0001899 3300042439 Bacteria 5050
131 Ga0439460_0015197 3300042461 Bacteria 2034
132 Ga0439460_0028763 3300042461 Bacteria 1570
133 Ga0450916_000072 3300042530 Bacteria 6092
134 Ga0439440_0000363 3300042993 Bacteria 7513
135 Ga0466959_0109347 3300045049 Bacteria 1974
136 Ga0466967_0313273 3300045976 Bacteria 1512
137 Ga0495598_0028444 3300046537 Bacteria 1551
138 Ga0496100_0196421 3300048903 Bacteria 1468
139 Ga0496101_0061930 3300048904 Bacteria 2719
140 Ga0496102_0006554 3300048905 Bacteria 9941
141 Ga0496102_0243065 3300048905 Bacteria 1697
142 Ga0496103_0035075 3300048906 Bacteria 3070
143 Ga0496104_0238523 3300048907 Bacteria 1730
144 Ga0496108_0006656 3300048911 Bacteria 9358
145 Ga0496109_0006589 3300048912 Bacteria 9777
146 Ga0496110_0018203 3300048913 Bacteria 5887
147 Ga0496110_0074967 3300048913 Bacteria 3006
148 Ga0496112_0001962 3300048915 Bacteria 16257
149 Ga0496112_0039269 3300048915 Bacteria 4625
150 Ga0496112_0142040 3300048915 Bacteria 2370
151 Ga0496114_0097562 3300048917 Bacteria 2504
152 Ga0496114_0136659 3300048917 Bacteria 2120
153 Ga0496114_0329585 3300048917 Bacteria 1349
154 Ga0496115_0017246 3300048918 Bacteria 5514
155 Ga0496115_0079392 3300048918 Bacteria 2671
156 Ga0501031_0003631 3300049568 Bacteria 9929
157 Ga0501031_0012405 3300049568 Bacteria 5557
158 Ga0501033_0083759 3300049570 Bacteria 2337
159 Ga0501036_0033144 3300049572 Bacteria 4368
160 Ga0501036_0145977 3300049572 Bacteria 1995
161 Ga0501037_0007915 3300049573 Bacteria 7789
162 Ga0501039_0002883 3300049575 Bacteria 12868
163 Ga0501039_0006084 3300049575 Bacteria 9161
164 Ga0501040_0004184 3300049576 Bacteria 9389
165 Ga0501040_0004229 3300049576 Bacteria 9345
166 Ga0501041_0003187 3300049577 Bacteria 9435
167 Ga0501041_0009817 3300049577 Bacteria 5635
168 Ga0501041_0035370 3300049577 Bacteria 3026
169 Ga0501042_0002172 3300049578 Bacteria 11946
170 Ga0501042_0063754 3300049578 Bacteria 2633
171 Ga0501042_0066839 3300049578 Bacteria 2570
172 Ga0501046_0004922 3300049580 Bacteria 12012
173 Ga0501046_0027051 3300049580 Bacteria 4682
174 Ga0501048_0003130 3300049582 Bacteria 12636
175 Ga0501048_0007932 3300049582 Bacteria 8043
176 Ga0501067_0008097 3300049583 Bacteria 5838
177 Ga0501068_0072570 3300049584 Bacteria 2102
178 Ga0501069_0003441 3300049585 Bacteria 8136
179 Ga0501069_0048413 3300049585 Bacteria 2360
180 Ga0501070_0250522 3300049586 Bacteria 1449
181 Ga0501071_0001632 3300049587 Bacteria 13173
182 Ga0501071_0154484 3300049587 Bacteria 1713
183 Ga0501071_0202090 3300049587 Bacteria 1493
184 Ga0501072_0004544 3300049588 Bacteria 10549
185 Ga0501072_0040721 3300049588 Bacteria 3649
186 Ga0501072_0230128 3300049588 Bacteria 1477
187 Ga0501074_0003709 3300049590 Bacteria 10831
188 Ga0501074_0012634 3300049590 Bacteria 6141
189 Ga0501074_0042477 3300049590 Unclassified 3290
190 Ga0501075_0007020 3300049591 Bacteria 7779
191 Ga0501075_0008057 3300049591 Bacteria 7325
192 Ga0501075_0337394 3300049591 Bacteria 1149
193 Ga0501076_0003550 3300049592 Bacteria 10958
194 Ga0501076_0005239 3300049592 Bacteria 9296
195 Ga0501077_0000779 3300049593 Bacteria 19273
196 Ga0501077_0040906 3300049593 Bacteria 2951
197 Ga0501079_0004077 3300049741 Bacteria 10822
198 Ga0501079_0010801 3300049741 Bacteria 6954
199 Ga0501079_0024087 3300049741 Unclassified 4670
200 Ga0501081_0003874 3300049743 Bacteria 9588
201 Ga0501081_0008056 3300049743 Bacteria 6838
202 Ga0501083_0182312 3300049744 Bacteria 1371
203 Ga0501035_0083252 3300049822 Bacteria 2823
204 Ga0501044_0070422 3300049823 Bacteria 3557
205 Ga0501045_0000531 3300049824 Bacteria 23816
206 Ga0501045_0003669 3300049824 Bacteria 10559
207 nmdc:mga05p37_22769_c1 3300050507 Bacteria 7599
208 nmdc:mga05p37_85119_c1 3300050507 Bacteria 3896
209 nmdc:mga0a205_45092_c1 3300050515 Bacteria 4252
210 Ga0501084_0006581 3300054114 Bacteria 9548
211 Ga0501084_0007319 3300054114 Bacteria 9091
212 Ga0590074_006034 3300059423 Bacteria 2010
213 Ga0590075_000534 3300059424 Bacteria 10273
214 Ga0501082_0006128 3300060353 Bacteria 10438
215 Ga0501082_0006781 3300060353 Bacteria 9897
216 Ga0530510_0000751 3300061734 Bacteria 21029
217 Ga0530510_0029068 3300061734 Bacteria 3965
218 Ga0530510_0035003 3300061734 Bacteria 3619
219 Ga0530510_0385077 3300061734 Bacteria 1056
220 Ga0114129_10206491
221 rootL2_10288739
222 JGI25407J50210_10004335
223 Ga0070668_100035938
224 Ga0070714_100075951
225 Ga0070713_100051010
226 Ga0070713_100087542
227 Ga0068856_100386595
228 Ga0068861_100156320
229 Ga0081455_10061019
230 Ga0081538_10004863
231 Ga0081538_10008325
232 Ga0081538_10008993
233 Ga0081538_10018115
234 Ga0081538_10033320
235 Ga0081539_10002898
236 Ga0081539_10005315
237 Ga0081539_10014372
238 Ga0081539_10025465
239 Ga0081539_10049512
240 Ga0070717_10028955
241 Ga0070717_10194147
242 Ga0070717_10240230
243 Ga0070717_10271313
244 Ga0075365_10003104
245 Ga0070712_100041697
246 Ga0075436_100007629
247 Ga0075436_100201645
248 Ga0111539_10131710
249 Ga0114129_10007775
250 Ga0114129_10191460
251 Ga0114129_10955580
252 Ga0105249_10142568
253 Ga0157369_10009201
254 Ga0163162_10224340
255 Ga0157372_10392755
256 Ga0213876_10005271
257 Ga0213875_10036716
258 Ga0207693_10005577
259 Ga0207693_10098533
260 Ga0207687_10231797
261 Ga0207702_10166400
262 Ga0207702_10645627
263 Ga0207675_100005816
264 Ga0207698_10147458
265 Ga0307408_100012883
266 Ga0307405_10014617
267 Ga0307405_10023921
268 Ga0307413_10010302
269 Ga0307413_10118622
270 Ga0307410_10021510
271 Ga0307410_10022822
272 Ga0307410_10057757
273 Ga0307410_10063525
274 Ga0307406_10123636
275 Ga0307406_10127687
276 Ga0307406_10186332
277 Ga0307407_10001201
278 Ga0307407_10026953
279 Ga0307412_10160125
280 Ga0307409_100003927
281 Ga0307409_100005376
282 Ga0307409_100013993
283 Ga0307409_100041811
284 Ga0307416_100001334
285 Ga0307416_100013202
286 Ga0307416_100053737
287 Ga0307416_100070365
288 Ga0307416_100104850
289 Ga0307416_100236401
290 Ga0307411_10050268
291 Ga0307415_100006496
292 Ga0307415_100007344
293 Ga0307415_100011202
294 Ga0307415_100025869
295 Ga0307415_100432232
296 Ga0395899_0049216
297 Ga0395899_0134911
298 Ga0395899_0312996
299 Ga0395900_0001291
300 Ga0395900_0003136
301 Ga0395900_0004208
302 Ga0395900_0031744
303 Ga0395900_0036552
304 Ga0395900_0039615
305 Ga0395900_0059917
306 Ga0395900_0069357
307 Ga0395900_0078518
308 Ga0395900_0167138
309 Ga0395898_0007590
310 Ga0395898_0015020
311 Ga0395898_0038057
312 Ga0395898_0064538
313 Ga0395898_0395550
314 Ga0395898_0557943
315 Ga0395905_0004895
316 Ga0395905_0010536
317 Ga0395905_0041224
318 Ga0395905_0049807
319 Ga0395905_0111453
320 Ga0395905_0121645
321 Ga0436364_0721738
322 Ga0395901_0000365
323 Ga0395901_0000733
324 Ga0395901_0006375
325 Ga0395901_0006872
326 Ga0395901_0079355
327 Ga0395901_0127326
328 Ga0395901_0166370
329 Ga0395901_0192362
330 Ga0436365_0929639
331 Ga0436365_1027412
332 Ga0436363_0245746
333 Ga0436363_0897861
334 Ga0436363_0925378
335 Ga0439448_0000530
336 Ga0439448_0028325
337 Ga0439450_000277
338 Ga0439454_002358
339 Ga0439455_0000540
340 Ga0439455_0040080
341 Ga0439463_001090
342 Ga0439463_012174
343 Ga0450900_013020
344 Ga0450902_019910
345 Ga0450889_003301
346 Ga0450910_007482
347 Ga0439444_0005907
348 Ga0439444_0006538
349 Ga0439464_0001899
350 Ga0439460_0015197
351 Ga0439460_0028763
352 Ga0450916_000072
353 Ga0439440_0000363
354 Ga0466959_0109347
355 Ga0466967_0313273
356 Ga0495598_0028444
357 Ga0496100_0196421
358 Ga0496101_0061930
359 Ga0496102_0006554
360 Ga0496102_0243065
361 Ga0496103_0035075
362 Ga0496104_0238523
363 Ga0496108_0006656
364 Ga0496109_0006589
365 Ga0496110_0018203
366 Ga0496110_0074967
367 Ga0496112_0001962
368 Ga0496112_0039269
369 Ga0496112_0142040
370 Ga0496114_0097562
371 Ga0496114_0136659
372 Ga0496114_0329585
373 Ga0496115_0017246
374 Ga0496115_0079392
375 Ga0501031_0003631
376 Ga0501031_0012405
377 Ga0501033_0083759
378 Ga0501036_0033144
379 Ga0501036_0145977
380 Ga0501037_0007915
381 Ga0501039_0002883
382 Ga0501039_0006084
383 Ga0501040_0004184
384 Ga0501040_0004229
385 Ga0501041_0003187
386 Ga0501041_0009817
387 Ga0501041_0035370
388 Ga0501042_0002172
389 Ga0501042_0063754
390 Ga0501042_0066839
391 Ga0501046_0004922
392 Ga0501046_0027051
393 Ga0501048_0003130
394 Ga0501048_0007932
395 Ga0501067_0008097
396 Ga0501068_0072570
397 Ga0501069_0003441
398 Ga0501069_0048413
399 Ga0501070_0250522
400 Ga0501071_0001632
401 Ga0501071_0154484
402 Ga0501071_0202090
403 Ga0501072_0004544
404 Ga0501072_0040721
405 Ga0501072_0230128
406 Ga0501074_0003709
407 Ga0501074_0012634
408 Ga0501074_0042477
409 Ga0501075_0007020
410 Ga0501075_0008057
411 Ga0501075_0337394
412 Ga0501076_0003550
413 Ga0501076_0005239
414 Ga0501077_0000779
415 Ga0501077_0040906
416 Ga0501079_0004077
417 Ga0501079_0010801
418 Ga0501079_0024087
419 Ga0501081_0003874
420 Ga0501081_0008056
421 Ga0501083_0182312
422 Ga0501035_0083252
423 Ga0501044_0070422
424 Ga0501045_0000531
425 Ga0501045_0003669
426 nmdc:mga05p37_22769_c1
427 nmdc:mga05p37_85119_c1
428 nmdc:mga0a205_45092_c1
429 Ga0501084_0006581
430 Ga0501084_0007319
431 Ga0590074_006034
432 Ga0590075_000534
433 Ga0501082_0006128
434 Ga0501082_0006781
435 Ga0530510_0000751
436 Ga0530510_0029068
437 Ga0530510_0035003
438 Ga0530510_0385077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u6d-assembly1.cif.gz_A zg3615, a family 117 glycoside hydrolase in complex with beta-3,6-anhydro-l-galactose 0.7692 74 247
7zei-assembly4.cif.gz_D thermostable gh159 glycoside hydrolase from caldicellulosiruptor at 1.7 a 0.7388 18 244
6r3r-assembly1.cif.gz_A first crystal structure of endo-levanase bt1760 from bacteroides thetaiotaomicron 0.7382 10 230
4udk-assembly1.cif.gz_C crystal structure of b-1,4-mannopyranosyl-chitobiose phosphorylase at 1.76 angstrom from unknown human gut bacteria (uhgb_mp) in complex with n-acetyl-d-glucosamine, beta-d-mannopyranose and inorganic phosphate 0.7307 18 241
4udg-assembly1.cif.gz_F crystal structure of b-1,4-mannopyranosyl-chitobiose phosphorylase at 1.60 angstrom in complex with n-acetylglucosamine and inorganic phosphate 0.7253 21 236
ID Description Score Start End Superfamily
af_P9WLW7_145_299_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.771 73 229 2.115.10.20
af_P9WLW7_145_299_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.7533 73 229 2.115.10.20
af_Q2G055_3_110_3.30.160.100 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.7407 77 117 3.30.160.100
af_P9WLW7_1_144_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.717 123 250 2.115.10.20
af_A0A1D6EWZ8_90_279_2.115.10.20 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.7143 18 195 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A849A778-F1-model_v4 Glycosyl hydrolase family 32 0.9067 15 240
AF-A0A2P9IAZ3-F1-model_v4 deleted 0.8952 18 250
AF-A0A543MFI2-F1-model_v4 deleted 0.895 15 252
AF-A0A7W9L7N1-F1-model_v4 Glycosyl hydrolase family 32 N-terminal domain-containing protein 0.8927 70 256
AF-A0A5M3WWQ4-F1-model_v4 Glycosyl hydrolase family 32 N-terminal domain-containing protein 0.8828 4 241

Map