F330984

General Info

Members Datasets Scaffolds Average Seq Length
219 119 438 270

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100171351|Ga0075435_1001713513
Length 254
Sequence VTGSKYWHVIGIGIQNNLTYRFNFLARTLFGFIPLIAILYVWRTIYEGKGHQGTVGNYSLAEMVSYYLLVTIVDALTAVNEDDWQIAADIKDGNISQFLLKPIDYLTYRLCLFISGRMTYLAVACIPLAIFILSLSKYFVLPQSWTAFTSYALAMLAFWVLEVSTFIFIVFAFEYIASGHLFPLDILPHGLREVLFFTPFPYQLYFPVSVYMGKTVGGELIRGLLVQSFWVALGYVIARFAWSRGIKKYSAVGG

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
63 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.54
Stem 0
Stem Tuber 0
Unclassified 26.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100171351 3300007076 Unclassified 1831
2 rootH2_10102906 3300003320 Bacteria 2838
3 Ga0070690_100304042 3300005330 Unclassified 1144
4 Ga0070666_10016728 3300005335 Unclassified 4695
5 Ga0070689_100079834 3300005340 Bacteria 2567
6 Ga0070689_100420865 3300005340 Unclassified 1132
7 Ga0070669_100537618 3300005353 Bacteria 973
8 Ga0070675_100060715 3300005354 Bacteria 3121
9 Ga0070688_100037972 3300005365 Bacteria 2938
10 Ga0070688_100106889 3300005365 Bacteria 1854
11 Ga0070688_100125760 3300005365 Bacteria 1723
12 Ga0070714_100026565 3300005435 Bacteria 4786
13 Ga0070714_100474829 3300005435 Bacteria 1190
14 Ga0070701_10193436 3300005438 Bacteria 1198
15 Ga0070711_100211140 3300005439 Bacteria 1503
16 Ga0070694_100002512 3300005444 Bacteria 10832
17 Ga0070708_100102294 3300005445 Bacteria 2625
18 Ga0070681_10024957 3300005458 Bacteria 6014
19 Ga0070681_10179852 3300005458 Unclassified 2036
20 Ga0070681_10433030 3300005458 Bacteria 1227
21 Ga0070685_10010498 3300005466 Bacteria 4813
22 Ga0070707_100279308 3300005468 Bacteria 1623
23 Ga0070679_100088076 3300005530 Unclassified 3092
24 Ga0070679_100113143 3300005530 Unclassified 2700
25 Ga0068855_100074727 3300005563 Bacteria 3935
26 Ga0068855_100156201 3300005563 Unclassified 2591
27 Ga0068855_100185120 3300005563 Bacteria 2352
28 Ga0068855_100230796 3300005563 Unclassified 2072
29 Ga0068857_100063087 3300005577 Bacteria 3294
30 Ga0068857_100256678 3300005577 Bacteria 1604
31 Ga0068856_100002021 3300005614 Bacteria 21122
32 Ga0068856_100050859 3300005614 Bacteria 4086
33 Ga0068856_100287623 3300005614 Bacteria 1661
34 Ga0068859_100063395 3300005617 Bacteria 3727
35 Ga0068859_100357829 3300005617 Unclassified 1555
36 Ga0068864_100338951 3300005618 Bacteria 1416
37 Ga0068863_100032119 3300005841 Bacteria 5006
38 Ga0068863_100047907 3300005841 Unclassified 4053
39 Ga0068863_100345929 3300005841 Bacteria 1447
40 Ga0081455_10103817 3300005937 Unclassified 2275
41 Ga0097621_100041805 3300006237 Unclassified 3691
42 Ga0068871_100215404 3300006358 Unclassified 1662
43 Ga0075434_100197396 3300006871 Unclassified 2032
44 Ga0075429_100215227 3300006880 Bacteria 1683
45 Ga0075436_100054473 3300006914 Bacteria 2761
46 Ga0097620_100063393 3300006931 Bacteria 3727
47 Ga0097620_100284859 3300006931 Unclassified 1745
48 Ga0097620_100357834 3300006931 Unclassified 1555
49 Ga0099794_10235600 3300007265 Bacteria 942
50 Ga0099795_10040093 3300007788 Bacteria 1661
51 Ga0105240_10003400 3300009093 Bacteria 24748
52 Ga0105240_10021026 3300009093 Bacteria 8685
53 Ga0105240_10047126 3300009093 Bacteria 5456
54 Ga0105240_10187881 3300009093 Bacteria 2432
55 Ga0105240_10412584 3300009093 Unclassified 1519
56 Ga0105240_10780060 3300009093 Unclassified 1037
57 Ga0111539_10238874 3300009094 Bacteria 2115
58 Ga0111539_10564632 3300009094 Bacteria 1325
59 Ga0111539_10602914 3300009094 Bacteria 1279
60 Ga0105245_10231135 3300009098 Unclassified 1789
61 Ga0105248_10290064 3300009177 Bacteria 1842
62 Ga0105248_10703862 3300009177 Unclassified 1140
63 Ga0105238_10001107 3300009551 Bacteria 27230
64 Ga0105238_10089240 3300009551 Bacteria 3070
65 Ga0105249_10466987 3300009553 Bacteria 1303
66 Ga0105239_10999668 3300010375 Unclassified 962
67 Ga0157370_10023781 3300013104 Bacteria 6078
68 Ga0157374_10196896 3300013296 Unclassified 1972
69 Ga0157374_10373891 3300013296 Unclassified 1419
70 Ga0157372_10357098 3300013307 Bacteria 1703
71 Ga0157375_10000068 3300013308 Bacteria 110172
72 Ga0157375_10130387 3300013308 Unclassified 2633
73 Ga0207680_10009928 3300025903 Bacteria 4742
74 Ga0207707_10083481 3300025912 Bacteria 2790
75 Ga0207707_10221086 3300025912 Bacteria 1648
76 Ga0207707_10360823 3300025912 Bacteria 1251
77 Ga0207695_10035171 3300025913 Bacteria 5437
78 Ga0207695_10058813 3300025913 Bacteria 3989
79 Ga0207695_10136125 3300025913 Unclassified 2409
80 Ga0207695_10560447 3300025913 Bacteria 1024
81 Ga0207652_10062509 3300025921 Unclassified 3218
82 Ga0207652_10064985 3300025921 Unclassified 3158
83 Ga0207646_10294945 3300025922 Bacteria 1465
84 Ga0207646_10509440 3300025922 Unclassified 1084
85 Ga0207694_10002636 3300025924 Bacteria 14541
86 Ga0207694_10151996 3300025924 Bacteria 1865
87 Ga0207664_10031601 3300025929 Bacteria 4052
88 Ga0207664_10562255 3300025929 Bacteria 1024
89 Ga0207670_10010304 3300025936 Bacteria 5377
90 Ga0207670_10021221 3300025936 Bacteria 4003
91 Ga0207670_10028599 3300025936 Bacteria 3542
92 Ga0207670_10032070 3300025936 Bacteria 3375
93 Ga0207670_10160332 3300025936 Bacteria 1678
94 Ga0207667_10012330 3300025949 Bacteria 9859
95 Ga0207667_10204427 3300025949 Bacteria 2026
96 Ga0207667_10265567 3300025949 Bacteria 1755
97 Ga0207712_10319878 3300025961 Bacteria 1280
98 Ga0207702_10001962 3300026078 Bacteria 20027
99 Ga0207702_10067507 3300026078 Bacteria 3069
100 Ga0207702_10081634 3300026078 Unclassified 2808
101 Ga0207641_10038788 3300026088 Bacteria 3983
102 Ga0207641_10541694 3300026088 Bacteria 1134
103 Ga0207674_10079009 3300026116 Bacteria 3295
104 Ga0207674_10557504 3300026116 Bacteria 1107
105 Ga0265337_1000195 3300028556 Bacteria 32084
106 Ga0265337_1000682 3300028556 Bacteria 17910
107 Ga0265337_1014817 3300028556 Bacteria 2574
108 Ga0265326_10008296 3300028558 Unclassified 3138
109 Ga0265319_1000016 3300028563 Bacteria 176245
110 Ga0265334_10005420 3300028573 Bacteria 5573
111 Ga0265334_10025454 3300028573 Bacteria 2394
112 Ga0265318_10005850 3300028577 Bacteria 5725
113 Ga0265323_10000453 3300028653 Bacteria 23261
114 Ga0265322_10020614 3300028654 Unclassified 1888
115 Ga0265336_10015817 3300028666 Unclassified 2475
116 Ga0265338_10000650 3300028800 Bacteria 59992
117 Ga0265338_10000946 3300028800 Bacteria 48852
118 Ga0265338_10001975 3300028800 Bacteria 31933
119 Ga0265338_10006868 3300028800 Bacteria 14329
120 Ga0265338_10024405 3300028800 Bacteria 6177
121 Ga0265338_10027467 3300028800 Bacteria 5710
122 Ga0265338_10028862 3300028800 Bacteria 5520
123 Ga0265338_10037322 3300028800 Bacteria 4628
124 Ga0265338_10057182 3300028800 Unclassified 3452
125 Ga0265338_10073684 3300028800 Unclassified 2909
126 Ga0265338_10109904 3300028800 Unclassified 2223
127 Ga0265338_10133943 3300028800 Bacteria 1952
128 Ga0265324_10000698 3300029957 Bacteria 22412
129 Ga0265324_10009454 3300029957 Bacteria 3804
130 Ga0265320_10000319 3300031240 Bacteria 39222
131 Ga0265320_10015415 3300031240 Unclassified 4322
132 Ga0265320_10016826 3300031240 Bacteria 4081
133 Ga0265320_10144555 3300031240 Bacteria 1076
134 Ga0265340_10000574 3300031247 Bacteria 20423
135 Ga0265327_10000379 3300031251 Bacteria 83712
136 Ga0265316_10081806 3300031344 Bacteria 2475
137 Ga0265316_10133129 3300031344 Bacteria 1871
138 Ga0265313_10001314 3300031595 Bacteria 23441
139 Ga0265314_10066586 3300031711 Unclassified 2429
140 Ga0265342_10064340 3300031712 Unclassified 2153
141 Ga0316576_10501528 3300031727 Unclassified 893
142 Ga0316577_10122445 3300031733 Unclassified 1462
143 Ga0373956_0004042 3300035119 Bacteria 5889
144 Ga0373956_0010484 3300035119 Bacteria 3800
145 Ga0373931_0188860 3300035691 Unclassified 1225
146 Ga0373937_0002215 3300036401 Bacteria 16242
147 Ga0373937_0093587 3300036401 Unclassified 2786
148 Ga0373937_0205522 3300036401 Unclassified 1852
149 Ga0373937_0417582 3300036401 Bacteria 1273
150 Ga0373925_0169775 3300037068 Bacteria 1722
151 Ga0451577_0002071 3300042876 Bacteria 24749
152 Ga0451577_0008547 3300042876 Bacteria 9958
153 Ga0453684_0002213 3300044712 Bacteria 48335
154 Ga0453684_0012272 3300044712 Bacteria 14187
155 Ga0453684_0507094 3300044712 Bacteria 1335
156 Ga0451576_0089048 3300045051 Bacteria 3210
157 Ga0451576_0126774 3300045051 Bacteria 2659
158 Ga0451576_0169920 3300045051 Bacteria 2276
159 Ga0451576_0388864 3300045051 Unclassified 1462
160 Ga0495641_0083278 3300046461 Unclassified 1433
161 Ga0495651_0245782 3300046462 Bacteria 1225
162 Ga0495582_0061809 3300046473 Bacteria 2069
163 Ga0495639_0022737 3300046475 Bacteria 2752
164 Ga0495662_0078398 3300046476 Bacteria 1605
165 Ga0495664_0075561 3300046477 Bacteria 2016
166 Ga0495583_0114772 3300046506 Bacteria 1139
167 Ga0495608_0074909 3300046511 Bacteria 2206
168 Ga0495608_0240274 3300046511 Unclassified 1132
169 Ga0495618_0001837 3300046514 Bacteria 13992
170 Ga0495618_0105534 3300046514 Bacteria 1804
171 Ga0495628_0161244 3300046516 Bacteria 1704
172 Ga0495628_0186865 3300046516 Bacteria 1566
173 Ga0495628_0225038 3300046516 Bacteria 1408
174 Ga0495628_0422907 3300046516 Unclassified 971
175 Ga0495630_0000136 3300046517 Bacteria 57957
176 Ga0495630_0104878 3300046517 Bacteria 2140
177 Ga0495630_0169069 3300046517 Bacteria 1665
178 Ga0495666_0008745 3300046526 Bacteria 5073
179 Ga0495666_0121138 3300046526 Unclassified 1225
180 Ga0495640_0028259 3300046533 Bacteria 4039
181 Ga0495586_0000018 3300046535 Bacteria 112658
182 Ga0495586_0000615 3300046535 Bacteria 20579
183 Ga0495586_0004661 3300046535 Bacteria 7331
184 Ga0495645_0056501 3300046543 Bacteria 2850
185 Ga0495645_0182063 3300046543 Bacteria 1439
186 Ga0495667_0122723 3300046559 Bacteria 1677
187 Ga0495634_0005861 3300046642 Bacteria 9385
188 Ga0495634_0058966 3300046642 Bacteria 2558
189 Ga0495634_0148799 3300046642 Bacteria 1482
190 Ga0495657_0037319 3300046675 Bacteria 3350
191 Ga0495599_0071293 3300046678 Unclassified 2169
192 Ga0495658_0008177 3300046683 Bacteria 5183
193 Ga0495658_0059259 3300046683 Bacteria 2192
194 Ga0495613_0000662 3300046689 Bacteria 27289
195 Ga0495613_0016149 3300046689 Bacteria 5560
196 Ga0495613_0089238 3300046689 Bacteria 2233
197 Ga0495674_0001179 3300047319 Bacteria 25244
198 Ga0495674_0023054 3300047319 Bacteria 5737
199 Ga0495676_0113916 3300047321 Bacteria 1979
200 Ga0495680_0015570 3300047322 Bacteria 6559
201 Ga0495675_0246999 3300047444 Bacteria 1073
202 Ga0495684_0101686 3300047471 Bacteria 2173
203 Ga0495684_0316886 3300047471 Unclassified 1116
204 Ga0495684_0414362 3300047471 Bacteria 943
205 Ga0501031_0000039 3300049568 Bacteria 72794
206 Ga0501031_0069606 3300049568 Unclassified 2292
207 Ga0501032_0004230 3300049569 Bacteria 10855
208 Ga0501032_0072268 3300049569 Unclassified 2299
209 Ga0501033_0001393 3300049570 Bacteria 21488
210 Ga0501043_0274193 3300049579 Unclassified 1294
211 Ga0501080_0293060 3300049742 Bacteria 1477
212 Ga0501035_0018427 3300049822 Bacteria 6433
213 Ga0501035_0048755 3300049822 Bacteria 3797
214 Ga0501044_0000133 3300049823 Bacteria 91116
215 Ga0501044_0050959 3300049823 Bacteria 4270
216 nmdc:mga08y16_266273_c1 3300050511 Unclassified 1769
217 nmdc:mga0n895_199549_c1 3300050512 Unclassified 2032
218 nmdc:mga0rr50_43539_c1 3300050513 Unclassified 3286
219 nmdc:mga0a205_328027_c1 3300050515 Unclassified 1400
220 Ga0075435_100171351
221 rootH2_10102906
222 Ga0070690_100304042
223 Ga0070666_10016728
224 Ga0070689_100079834
225 Ga0070689_100420865
226 Ga0070669_100537618
227 Ga0070675_100060715
228 Ga0070688_100037972
229 Ga0070688_100106889
230 Ga0070688_100125760
231 Ga0070714_100026565
232 Ga0070714_100474829
233 Ga0070701_10193436
234 Ga0070711_100211140
235 Ga0070694_100002512
236 Ga0070708_100102294
237 Ga0070681_10024957
238 Ga0070681_10179852
239 Ga0070681_10433030
240 Ga0070685_10010498
241 Ga0070707_100279308
242 Ga0070679_100088076
243 Ga0070679_100113143
244 Ga0068855_100074727
245 Ga0068855_100156201
246 Ga0068855_100185120
247 Ga0068855_100230796
248 Ga0068857_100063087
249 Ga0068857_100256678
250 Ga0068856_100002021
251 Ga0068856_100050859
252 Ga0068856_100287623
253 Ga0068859_100063395
254 Ga0068859_100357829
255 Ga0068864_100338951
256 Ga0068863_100032119
257 Ga0068863_100047907
258 Ga0068863_100345929
259 Ga0081455_10103817
260 Ga0097621_100041805
261 Ga0068871_100215404
262 Ga0075434_100197396
263 Ga0075429_100215227
264 Ga0075436_100054473
265 Ga0097620_100063393
266 Ga0097620_100284859
267 Ga0097620_100357834
268 Ga0099794_10235600
269 Ga0099795_10040093
270 Ga0105240_10003400
271 Ga0105240_10021026
272 Ga0105240_10047126
273 Ga0105240_10187881
274 Ga0105240_10412584
275 Ga0105240_10780060
276 Ga0111539_10238874
277 Ga0111539_10564632
278 Ga0111539_10602914
279 Ga0105245_10231135
280 Ga0105248_10290064
281 Ga0105248_10703862
282 Ga0105238_10001107
283 Ga0105238_10089240
284 Ga0105249_10466987
285 Ga0105239_10999668
286 Ga0157370_10023781
287 Ga0157374_10196896
288 Ga0157374_10373891
289 Ga0157372_10357098
290 Ga0157375_10000068
291 Ga0157375_10130387
292 Ga0207680_10009928
293 Ga0207707_10083481
294 Ga0207707_10221086
295 Ga0207707_10360823
296 Ga0207695_10035171
297 Ga0207695_10058813
298 Ga0207695_10136125
299 Ga0207695_10560447
300 Ga0207652_10062509
301 Ga0207652_10064985
302 Ga0207646_10294945
303 Ga0207646_10509440
304 Ga0207694_10002636
305 Ga0207694_10151996
306 Ga0207664_10031601
307 Ga0207664_10562255
308 Ga0207670_10010304
309 Ga0207670_10021221
310 Ga0207670_10028599
311 Ga0207670_10032070
312 Ga0207670_10160332
313 Ga0207667_10012330
314 Ga0207667_10204427
315 Ga0207667_10265567
316 Ga0207712_10319878
317 Ga0207702_10001962
318 Ga0207702_10067507
319 Ga0207702_10081634
320 Ga0207641_10038788
321 Ga0207641_10541694
322 Ga0207674_10079009
323 Ga0207674_10557504
324 Ga0265337_1000195
325 Ga0265337_1000682
326 Ga0265337_1014817
327 Ga0265326_10008296
328 Ga0265319_1000016
329 Ga0265334_10005420
330 Ga0265334_10025454
331 Ga0265318_10005850
332 Ga0265323_10000453
333 Ga0265322_10020614
334 Ga0265336_10015817
335 Ga0265338_10000650
336 Ga0265338_10000946
337 Ga0265338_10001975
338 Ga0265338_10006868
339 Ga0265338_10024405
340 Ga0265338_10027467
341 Ga0265338_10028862
342 Ga0265338_10037322
343 Ga0265338_10057182
344 Ga0265338_10073684
345 Ga0265338_10109904
346 Ga0265338_10133943
347 Ga0265324_10000698
348 Ga0265324_10009454
349 Ga0265320_10000319
350 Ga0265320_10015415
351 Ga0265320_10016826
352 Ga0265320_10144555
353 Ga0265340_10000574
354 Ga0265327_10000379
355 Ga0265316_10081806
356 Ga0265316_10133129
357 Ga0265313_10001314
358 Ga0265314_10066586
359 Ga0265342_10064340
360 Ga0316576_10501528
361 Ga0316577_10122445
362 Ga0373956_0004042
363 Ga0373956_0010484
364 Ga0373931_0188860
365 Ga0373937_0002215
366 Ga0373937_0093587
367 Ga0373937_0205522
368 Ga0373937_0417582
369 Ga0373925_0169775
370 Ga0451577_0002071
371 Ga0451577_0008547
372 Ga0453684_0002213
373 Ga0453684_0012272
374 Ga0453684_0507094
375 Ga0451576_0089048
376 Ga0451576_0126774
377 Ga0451576_0169920
378 Ga0451576_0388864
379 Ga0495641_0083278
380 Ga0495651_0245782
381 Ga0495582_0061809
382 Ga0495639_0022737
383 Ga0495662_0078398
384 Ga0495664_0075561
385 Ga0495583_0114772
386 Ga0495608_0074909
387 Ga0495608_0240274
388 Ga0495618_0001837
389 Ga0495618_0105534
390 Ga0495628_0161244
391 Ga0495628_0186865
392 Ga0495628_0225038
393 Ga0495628_0422907
394 Ga0495630_0000136
395 Ga0495630_0104878
396 Ga0495630_0169069
397 Ga0495666_0008745
398 Ga0495666_0121138
399 Ga0495640_0028259
400 Ga0495586_0000018
401 Ga0495586_0000615
402 Ga0495586_0004661
403 Ga0495645_0056501
404 Ga0495645_0182063
405 Ga0495667_0122723
406 Ga0495634_0005861
407 Ga0495634_0058966
408 Ga0495634_0148799
409 Ga0495657_0037319
410 Ga0495599_0071293
411 Ga0495658_0008177
412 Ga0495658_0059259
413 Ga0495613_0000662
414 Ga0495613_0016149
415 Ga0495613_0089238
416 Ga0495674_0001179
417 Ga0495674_0023054
418 Ga0495676_0113916
419 Ga0495680_0015570
420 Ga0495675_0246999
421 Ga0495684_0101686
422 Ga0495684_0316886
423 Ga0495684_0414362
424 Ga0501031_0000039
425 Ga0501031_0069606
426 Ga0501032_0004230
427 Ga0501032_0072268
428 Ga0501033_0001393
429 Ga0501043_0274193
430 Ga0501080_0293060
431 Ga0501035_0018427
432 Ga0501035_0048755
433 Ga0501044_0000133
434 Ga0501044_0050959
435 nmdc:mga08y16_266273_c1
436 nmdc:mga0n895_199549_c1
437 nmdc:mga0rr50_43539_c1
438 nmdc:mga0a205_328027_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06182

ABC2_membrane_6

ABC-2 family transporter protein

32

253

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.6335 15 275
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.6252 15 275
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.6198 33 275
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.6195 15 275
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.6119 15 275
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7029 77 274 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.661 67 273 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5058 67 273 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5057 77 274 3.40.1710.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3883 76 275 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7C3DJF0-F1-model_v4 ABC transporter permease 0.9518 20 286 GO:0016020
AF-A0A2V5QLY8-F1-model_v4 ABC transporter permease 0.9511 19 269 GO:0016020
AF-A0A7C3DJF0-F1-model_v4 ABC transporter permease 0.9449 20 286 GO:0016020
AF-A0A2V6E0T7-F1-model_v4 ABC transporter permease 0.9447 44 286 GO:0016020
AF-A0A3M1IM14-F1-model_v4 ABC transporter permease 0.9387 52 286 GO:0016020

Map