F330921

General Info

Members Datasets Scaffolds Average Seq Length
219 110 438 302

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10037891|Ga0075365_100378911
Length 333
Sequence VITPRKRAVAALRAEGPAAGTPQGMTEPSRRRPRLWRAARLLALGVVVAVCATLAPSSTVKPTDLALVKLNNASTVDVSPDVVWILAVGSDARPGEEMTHVRGDALQLIGMNTKTGAAASIGIPRDSYVYIDGVGSDKINAALYYGGPELLGATVGNLIGIQPDYVFITRFEKFRAMIGTIGGIEVDNPISFGDDYLKPEPFPAGKIHLGPWDALFFARIRHDLLRGDFDRSANQQRVLRGIQAKISQNAGNHGFIEKGVLSAMENMATNASPSELYRLARAAAAVKPSLITTCVLQGGIGDVGGASVVLPYLDQAKQMGDEARDDATLEDCP

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
23 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
35 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
37 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
49 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
50 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
60 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
61 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
71 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
76 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
77 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
78 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
79 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
83 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
84 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
85 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
86 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
87 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
88 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
89 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
90 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
91 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
92 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
93 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
96 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
97 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
98 2643221561 Nocardioides sp. Root151 Isolate Unclassified
99 2643221576 Nocardioides sp. Root614 Isolate Unclassified
100 2643221590 Nocardioides sp. Root682 Isolate Unclassified
101 2643221604 Nocardioides sp. Root190 Isolate Unclassified
102 2643221615 Nocardioides sp. Root224 Isolate Unclassified
103 2643221641 Nocardioides sp. Root122 Isolate Unclassified
104 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
105 2643221696 Nocardioides sp. Root140 Isolate Unclassified
106 2738541305 Nocardioides sp. CF167 Isolate Unclassified
107 2739367898 Nocardioides sp. CF479 Isolate Unclassified
108 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
109 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
110 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.06
Metatranscriptomes 0
Isolates 5.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 37.44
Nodule 0.46
Rhizoplane 0.91
Rhizosphere 54.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10037891 3300006038 Bacteria 3131
2 rootL2_10085021 3300003322 Bacteria 1896
3 Ga0070667_100232808 3300005367 Bacteria 1643
4 Ga0070700_100021561 3300005441 Bacteria 3746
5 Ga0068867_100311809 3300005459 Bacteria 1300
6 Ga0070698_100035505 3300005471 Bacteria 5155
7 Ga0070664_100497230 3300005564 Bacteria 1124
8 Ga0068857_100293299 3300005577 Bacteria 1498
9 Ga0068864_100188194 3300005618 Bacteria 1891
10 Ga0068866_10314065 3300005718 Bacteria 983
11 Ga0068861_100173673 3300005719 Bacteria 1788
12 Ga0068860_100003522 3300005843 Bacteria 16105
13 Ga0075365_10009237 3300006038 Bacteria 5655
14 Ga0075365_10019126 3300006038 Bacteria 4221
15 Ga0075365_10020260 3300006038 Bacteria 4120
16 Ga0075365_10025476 3300006038 Bacteria 3745
17 Ga0075365_10096808 3300006038 Bacteria 2017
18 Ga0075365_10105838 3300006038 Bacteria 1930
19 Ga0075365_10115243 3300006038 Bacteria 1849
20 Ga0075365_10135330 3300006038 Bacteria 1707
21 Ga0075365_10159175 3300006038 Bacteria 1573
22 Ga0075368_10001207 3300006042 Bacteria 8178
23 Ga0075368_10009756 3300006042 Bacteria 3460
24 Ga0075368_10050286 3300006042 Bacteria 1655
25 Ga0075363_100002688 3300006048 Bacteria 7350
26 Ga0075363_100019424 3300006048 Bacteria 3398
27 Ga0075363_100030518 3300006048 Bacteria 2791
28 Ga0075363_100040274 3300006048 Bacteria 2462
29 Ga0075363_100111747 3300006048 Bacteria 1519
30 Ga0075363_100133259 3300006048 Bacteria 1395
31 Ga0075363_100190082 3300006048 Bacteria 1171
32 Ga0075364_10037459 3300006051 Bacteria 3140
33 Ga0075364_10057545 3300006051 Bacteria 2547
34 Ga0075364_10066889 3300006051 Bacteria 2361
35 Ga0075364_10100036 3300006051 Bacteria 1930
36 Ga0075364_10196290 3300006051 Bacteria 1367
37 Ga0075364_10229498 3300006051 Bacteria 1261
38 Ga0075362_10017177 3300006177 Bacteria 2977
39 Ga0075367_10004051 3300006178 Bacteria 7090
40 Ga0075367_10009308 3300006178 Bacteria 5129
41 Ga0075367_10060085 3300006178 Bacteria 2265
42 Ga0075367_10075232 3300006178 Bacteria 2037
43 Ga0075367_10076131 3300006178 Bacteria 2024
44 Ga0075367_10114773 3300006178 Bacteria 1656
45 Ga0075367_10209682 3300006178 Bacteria 1218
46 Ga0075370_10014059 3300006353 Bacteria 4263
47 Ga0075370_10041387 3300006353 Bacteria 2601
48 Ga0075370_10055568 3300006353 Bacteria 2249
49 Ga0075370_10060031 3300006353 Bacteria 2166
50 Ga0075370_10137299 3300006353 Bacteria 1429
51 Ga0068865_100187163 3300006881 Bacteria 1598
52 Ga0157375_10048033 3300013308 Bacteria 4172
53 Ga0163163_10083045 3300014325 Bacteria 3208
54 Ga0163163_10352496 3300014325 Bacteria 1528
55 Ga0157380_10102666 3300014326 Bacteria 2384
56 Ga0157380_10370252 3300014326 Bacteria 1348
57 Ga0157380_10444835 3300014326 Bacteria 1243
58 Ga0157380_10770342 3300014326 Bacteria 976
59 Ga0207643_10253303 3300025908 Bacteria 1085
60 Ga0207650_10421469 3300025925 Bacteria 1108
61 Ga0207706_10481559 3300025933 Bacteria 1072
62 Ga0207709_10031093 3300025935 Bacteria 3113
63 Ga0207670_10263617 3300025936 Bacteria 1337
64 Ga0207704_10136379 3300025938 Bacteria 1709
65 Ga0207658_10004712 3300025986 Bacteria 9444
66 Ga0207678_10217234 3300026067 Bacteria 1636
67 Ga0207708_10019674 3300026075 Bacteria 5092
68 Ga0207708_10139543 3300026075 Bacteria 1900
69 Ga0207676_10139450 3300026095 Bacteria 2074
70 Ga0207698_10620477 3300026142 Bacteria 1068
71 Ga0209813_10010080 3300027866 Bacteria 2434
72 Ga0209813_10078621 3300027866 Bacteria 1086
73 Ga0268264_10000238 3300028381 Bacteria 105229
74 Ga0307408_100330138 3300031548 Bacteria 1288
75 Ga0307410_10104888 3300031852 Bacteria 2034
76 Ga0307406_10182295 3300031901 Bacteria 1530
77 Ga0307407_10149356 3300031903 Bacteria 1517
78 Ga0307407_10241215 3300031903 Bacteria 1233
79 Ga0307412_10028278 3300031911 Bacteria 3506
80 Ga0307412_10280470 3300031911 Bacteria 1308
81 Ga0307409_100018861 3300031995 Bacteria 4654
82 Ga0307409_100194001 3300031995 Bacteria 1811
83 Ga0307409_100216577 3300031995 Bacteria 1725
84 Ga0307409_100417881 3300031995 Bacteria 1286
85 Ga0307416_100225803 3300032002 Bacteria 1801
86 Ga0307416_100363961 3300032002 Bacteria 1469
87 Ga0307416_100513982 3300032002 Bacteria 1264
88 Ga0307414_10452796 3300032004 Bacteria 1126
89 Ga0307415_100042063 3300032126 Bacteria 3038
90 Ga0307415_100043119 3300032126 Bacteria 3007
91 Ga0395898_0205927 3300037466 Bacteria 1877
92 Ga0395901_0056636 3300038443 Bacteria 4078
93 Ga0395901_0195551 3300038443 Bacteria 2121
94 Ga0451853_2875333 3300041512 Bacteria 1966
95 Ga0439446_0046148 3300042156 Bacteria 1293
96 Ga0439434_0001810 3300042435 Bacteria 6212
97 Ga0466972_0009509 3300044658 Bacteria 4884
98 Ga0466972_0068188 3300044658 Bacteria 1699
99 Ga0466965_0115314 3300044683 Bacteria 1383
100 Ga0466966_0094978 3300044684 Bacteria 1848
101 Ga0466961_0122376 3300044693 Bacteria 1633
102 Ga0466964_0002124 3300044706 Bacteria 6986
103 Ga0466970_0006476 3300044765 Bacteria 5855
104 Ga0466970_0006513 3300044765 Bacteria 5837
105 Ga0466970_0065095 3300044765 Bacteria 1955
106 Ga0466970_0084000 3300044765 Bacteria 1723
107 Ga0466970_0091373 3300044765 Bacteria 1652
108 Ga0466957_0136406 3300044842 Bacteria 1577
109 Ga0466960_0000208 3300044901 Bacteria 20349
110 Ga0466960_0023574 3300044901 Bacteria 2765
111 Ga0466960_0027986 3300044901 Bacteria 2577
112 Ga0466960_0071818 3300044901 Bacteria 1724
113 Ga0466960_0111392 3300044901 Bacteria 1422
114 Ga0466967_0016535 3300045976 Bacteria 5822
115 Ga0466967_0208272 3300045976 Bacteria 1854
116 Ga0466967_0488377 3300045976 Bacteria 1207
117 Ga0496106_0364379 3300048909 Bacteria 1161
118 Ga0496114_0099903 3300048917 Bacteria 2475
119 Ga0501031_0028803 3300049568 Bacteria 3620
120 Ga0501031_0054273 3300049568 Bacteria 2611
121 Ga0501031_0093510 3300049568 Bacteria 1962
122 Ga0501032_0156665 3300049569 Bacteria 1496
123 Ga0501034_0034892 3300049571 Bacteria 5101
124 Ga0501036_0080254 3300049572 Bacteria 2758
125 Ga0501036_0243671 3300049572 Bacteria 1507
126 Ga0501038_0125958 3300049574 Bacteria 2108
127 Ga0501038_0202005 3300049574 Bacteria 1595
128 Ga0501038_0231812 3300049574 Bacteria 1469
129 Ga0501039_0342479 3300049575 Bacteria 1175
130 Ga0501039_0421528 3300049575 Bacteria 1048
131 Ga0501040_0013434 3300049576 Bacteria 5382
132 Ga0501040_0097288 3300049576 Bacteria 2050
133 Ga0501040_0139022 3300049576 Bacteria 1710
134 Ga0501040_0253591 3300049576 Bacteria 1255
135 Ga0501040_0298994 3300049576 Bacteria 1151
136 Ga0501042_0086495 3300049578 Bacteria 2248
137 Ga0501042_0133931 3300049578 Bacteria 1786
138 Ga0501048_0327452 3300049582 Bacteria 1091
139 Ga0501048_0330240 3300049582 Bacteria 1086
140 Ga0501068_0055589 3300049584 Bacteria 2398
141 Ga0501069_0154586 3300049585 Bacteria 1319
142 Ga0501070_0041536 3300049586 Bacteria 3831
143 Ga0501070_0281945 3300049586 Bacteria 1356
144 Ga0501071_0003911 3300049587 Bacteria 9389
145 Ga0501072_0055887 3300049588 Bacteria 3111
146 Ga0501072_0082513 3300049588 Bacteria 2548
147 Ga0501073_0032944 3300049589 Bacteria 3692
148 Ga0501075_0206859 3300049591 Bacteria 1497
149 Ga0501076_0098394 3300049592 Bacteria 2357
150 Ga0501076_0199630 3300049592 Bacteria 1633
151 Ga0501076_0410658 3300049592 Bacteria 1113
152 Ga0501077_0022533 3300049593 Bacteria 3990
153 Ga0501079_0013884 3300049741 Bacteria 6145
154 Ga0501079_0204793 3300049741 Bacteria 1541
155 Ga0501079_0313010 3300049741 Bacteria 1229
156 Ga0501080_0292430 3300049742 Bacteria 1479
157 Ga0501035_0155954 3300049822 Bacteria 1979
158 Ga0501035_0193227 3300049822 Bacteria 1749
159 Ga0501035_0270050 3300049822 Bacteria 1440
160 Ga0501045_0120166 3300049824 Bacteria 1951
161 nmdc:mga03683_12710_c1 3300050489 Bacteria 3082
162 nmdc:mga03n38_103683_c1 3300050490 Bacteria 1375
163 nmdc:mga03n38_108762_c1 3300050490 Bacteria 1347
164 nmdc:mga03n38_11454_c1 3300050490 Bacteria 3306
165 nmdc:mga03n38_11696_c1 3300050490 Bacteria 3279
166 nmdc:mga03n38_150695_c1 3300050490 Bacteria 1170
167 nmdc:mga03n38_21330_c1 3300050490 Bacteria 2605
168 nmdc:mga03n38_21838_c1 3300050490 Bacteria 2582
169 nmdc:mga03n38_36256_c1 3300050490 Bacteria 2119
170 nmdc:mga00v17_122171_c1 3300050491 Bacteria 1659
171 nmdc:mga00v17_168020_c1 3300050491 Bacteria 1413
172 nmdc:mga00v17_169885_c1 3300050491 Bacteria 1406
173 nmdc:mga00v17_252359_c1 3300050491 Bacteria 1144
174 nmdc:mga00v17_35702_c1 3300050491 Bacteria 2961
175 nmdc:mga00v17_62381_c1 3300050491 Bacteria 2293
176 nmdc:mga00v17_70284_c1 3300050491 Bacteria 2168
177 nmdc:mga00v17_77675_c1 3300050491 Bacteria 2068
178 nmdc:mga0yw44_13373_c1 3300050492 Bacteria 4320
179 nmdc:mga0yw44_13890_c1 3300050492 Bacteria 4256
180 nmdc:mga0yw44_152382_c1 3300050492 Bacteria 1509
181 nmdc:mga0yw44_15883_c1 3300050492 Bacteria 4050
182 nmdc:mga0yw44_17318_c1 3300050492 Bacteria 3919
183 nmdc:mga0yw44_186398_c1 3300050492 Bacteria 1367
184 nmdc:mga0yw44_189831_c1 3300050492 Bacteria 1355
185 nmdc:mga0yw44_201868_c1 3300050492 Bacteria 1313
186 nmdc:mga0yw44_2348_c1 3300050492 Bacteria 8020
187 nmdc:mga0yw44_60428_c1 3300050492 Bacteria 2322
188 nmdc:mga0yw44_73316_c1 3300050492 Bacteria 2130
189 nmdc:mga0yw44_90971_c1 3300050492 Bacteria 1928
190 nmdc:mga06z11_103145_c1 3300050494 Bacteria 1568
191 nmdc:mga06z11_13860_c1 3300050494 Bacteria 3554
192 nmdc:mga06z11_30476_c1 3300050494 Bacteria 2610
193 nmdc:mga06z11_36367_c1 3300050494 Bacteria 2431
194 nmdc:mga04h51_10127_c1 3300050495 Bacteria 2581
195 nmdc:mga04h51_18957_c1 3300050495 Bacteria 2034
196 nmdc:mga04h51_31297_c1 3300050495 Bacteria 1680
197 nmdc:mga07m45_17171_c1 3300050496 Bacteria 3882
198 Ga0500644_0000317 3300053088 Bacteria 25166
199 Ga0500554_039399 3300053102 Bacteria 1443
200 Ga0500556_0000284 3300053104 Bacteria 39641
201 Ga0500593_000507 3300053117 Bacteria 15307
202 Ga0501084_0403363 3300054114 Bacteria 1155
203 Ga0501084_0433079 3300054114 Bacteria 1112
204 Ga0590077_027034 3300059426 Bacteria 1242
205 Ga0501082_0272002 3300060353 Bacteria 1474
206 Ga0530510_0149341 3300061734 Bacteria 1725
207 2643828297 2643221561 Bacteria 4984412
208 2643889173 2643221576 Bacteria 5214352
209 2643958228 2643221590 Bacteria 5214697
210 2644036475 2643221604 Bacteria 5014917
211 2644090673 2643221615 Bacteria 5487866
212 2644230731 2643221641 Bacteria 4490190
213 2644320477 2643221657 Bacteria 5490246
214 2644535112 2643221696 Bacteria 5431823
215 2738867866 2738541305 Bacteria 4910150
216 2740167635 2739367898 Bacteria 4367674
217 2855390684 2855386786 Bacteria 4752232
218 2857482261 2857481737 Bacteria 4761446
219 8054613203 8054609563 Bacteria 5170090
220 Ga0075365_10037891
221 rootL2_10085021
222 Ga0070667_100232808
223 Ga0070700_100021561
224 Ga0068867_100311809
225 Ga0070698_100035505
226 Ga0070664_100497230
227 Ga0068857_100293299
228 Ga0068864_100188194
229 Ga0068866_10314065
230 Ga0068861_100173673
231 Ga0068860_100003522
232 Ga0075365_10009237
233 Ga0075365_10019126
234 Ga0075365_10020260
235 Ga0075365_10025476
236 Ga0075365_10096808
237 Ga0075365_10105838
238 Ga0075365_10115243
239 Ga0075365_10135330
240 Ga0075365_10159175
241 Ga0075368_10001207
242 Ga0075368_10009756
243 Ga0075368_10050286
244 Ga0075363_100002688
245 Ga0075363_100019424
246 Ga0075363_100030518
247 Ga0075363_100040274
248 Ga0075363_100111747
249 Ga0075363_100133259
250 Ga0075363_100190082
251 Ga0075364_10037459
252 Ga0075364_10057545
253 Ga0075364_10066889
254 Ga0075364_10100036
255 Ga0075364_10196290
256 Ga0075364_10229498
257 Ga0075362_10017177
258 Ga0075367_10004051
259 Ga0075367_10009308
260 Ga0075367_10060085
261 Ga0075367_10075232
262 Ga0075367_10076131
263 Ga0075367_10114773
264 Ga0075367_10209682
265 Ga0075370_10014059
266 Ga0075370_10041387
267 Ga0075370_10055568
268 Ga0075370_10060031
269 Ga0075370_10137299
270 Ga0068865_100187163
271 Ga0157375_10048033
272 Ga0163163_10083045
273 Ga0163163_10352496
274 Ga0157380_10102666
275 Ga0157380_10370252
276 Ga0157380_10444835
277 Ga0157380_10770342
278 Ga0207643_10253303
279 Ga0207650_10421469
280 Ga0207706_10481559
281 Ga0207709_10031093
282 Ga0207670_10263617
283 Ga0207704_10136379
284 Ga0207658_10004712
285 Ga0207678_10217234
286 Ga0207708_10019674
287 Ga0207708_10139543
288 Ga0207676_10139450
289 Ga0207698_10620477
290 Ga0209813_10010080
291 Ga0209813_10078621
292 Ga0268264_10000238
293 Ga0307408_100330138
294 Ga0307410_10104888
295 Ga0307406_10182295
296 Ga0307407_10149356
297 Ga0307407_10241215
298 Ga0307412_10028278
299 Ga0307412_10280470
300 Ga0307409_100018861
301 Ga0307409_100194001
302 Ga0307409_100216577
303 Ga0307409_100417881
304 Ga0307416_100225803
305 Ga0307416_100363961
306 Ga0307416_100513982
307 Ga0307414_10452796
308 Ga0307415_100042063
309 Ga0307415_100043119
310 Ga0395898_0205927
311 Ga0395901_0056636
312 Ga0395901_0195551
313 Ga0451853_2875333
314 Ga0439446_0046148
315 Ga0439434_0001810
316 Ga0466972_0009509
317 Ga0466972_0068188
318 Ga0466965_0115314
319 Ga0466966_0094978
320 Ga0466961_0122376
321 Ga0466964_0002124
322 Ga0466970_0006476
323 Ga0466970_0006513
324 Ga0466970_0065095
325 Ga0466970_0084000
326 Ga0466970_0091373
327 Ga0466957_0136406
328 Ga0466960_0000208
329 Ga0466960_0023574
330 Ga0466960_0027986
331 Ga0466960_0071818
332 Ga0466960_0111392
333 Ga0466967_0016535
334 Ga0466967_0208272
335 Ga0466967_0488377
336 Ga0496106_0364379
337 Ga0496114_0099903
338 Ga0501031_0028803
339 Ga0501031_0054273
340 Ga0501031_0093510
341 Ga0501032_0156665
342 Ga0501034_0034892
343 Ga0501036_0080254
344 Ga0501036_0243671
345 Ga0501038_0125958
346 Ga0501038_0202005
347 Ga0501038_0231812
348 Ga0501039_0342479
349 Ga0501039_0421528
350 Ga0501040_0013434
351 Ga0501040_0097288
352 Ga0501040_0139022
353 Ga0501040_0253591
354 Ga0501040_0298994
355 Ga0501042_0086495
356 Ga0501042_0133931
357 Ga0501048_0327452
358 Ga0501048_0330240
359 Ga0501068_0055589
360 Ga0501069_0154586
361 Ga0501070_0041536
362 Ga0501070_0281945
363 Ga0501071_0003911
364 Ga0501072_0055887
365 Ga0501072_0082513
366 Ga0501073_0032944
367 Ga0501075_0206859
368 Ga0501076_0098394
369 Ga0501076_0199630
370 Ga0501076_0410658
371 Ga0501077_0022533
372 Ga0501079_0013884
373 Ga0501079_0204793
374 Ga0501079_0313010
375 Ga0501080_0292430
376 Ga0501035_0155954
377 Ga0501035_0193227
378 Ga0501035_0270050
379 Ga0501045_0120166
380 nmdc:mga03683_12710_c1
381 nmdc:mga03n38_103683_c1
382 nmdc:mga03n38_108762_c1
383 nmdc:mga03n38_11454_c1
384 nmdc:mga03n38_11696_c1
385 nmdc:mga03n38_150695_c1
386 nmdc:mga03n38_21330_c1
387 nmdc:mga03n38_21838_c1
388 nmdc:mga03n38_36256_c1
389 nmdc:mga00v17_122171_c1
390 nmdc:mga00v17_168020_c1
391 nmdc:mga00v17_169885_c1
392 nmdc:mga00v17_252359_c1
393 nmdc:mga00v17_35702_c1
394 nmdc:mga00v17_62381_c1
395 nmdc:mga00v17_70284_c1
396 nmdc:mga00v17_77675_c1
397 nmdc:mga0yw44_13373_c1
398 nmdc:mga0yw44_13890_c1
399 nmdc:mga0yw44_152382_c1
400 nmdc:mga0yw44_15883_c1
401 nmdc:mga0yw44_17318_c1
402 nmdc:mga0yw44_186398_c1
403 nmdc:mga0yw44_189831_c1
404 nmdc:mga0yw44_201868_c1
405 nmdc:mga0yw44_2348_c1
406 nmdc:mga0yw44_60428_c1
407 nmdc:mga0yw44_73316_c1
408 nmdc:mga0yw44_90971_c1
409 nmdc:mga06z11_103145_c1
410 nmdc:mga06z11_13860_c1
411 nmdc:mga06z11_30476_c1
412 nmdc:mga06z11_36367_c1
413 nmdc:mga04h51_10127_c1
414 nmdc:mga04h51_18957_c1
415 nmdc:mga04h51_31297_c1
416 nmdc:mga07m45_17171_c1
417 Ga0500644_0000317
418 Ga0500554_039399
419 Ga0500556_0000284
420 Ga0500593_000507
421 Ga0501084_0403363
422 Ga0501084_0433079
423 Ga0590077_027034
424 Ga0501082_0272002
425 Ga0530510_0149341
426 2643828297
427 2643889173
428 2643958228
429 2644036475
430 2644090673
431 2644230731
432 2644320477
433 2644535112
434 2738867866
435 2740167635
436 2855390684
437 2857482261
438 8054613203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03816

LytR_cpsA_psr

LytR_cpsA_psr family

102

248

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tel-assembly1.cif.gz_A lytr-cps2a-psr family protein with bound octaprenyl pyrophosphate lipid and manganese ion 0.8568 57 305
3tfl-assembly1.cif.gz_A lytr-cps2a-psr family protein with bound octaprenyl pyrophosphate lipid 0.848 57 310
4de9-assembly1.cif.gz_A lytr-cps2a-psr family protein ywtf (tagt) with bound octaprenyl pyrophosphate lipid 0.8439 56 309
6mps-assembly1.cif.gz_A tagt bound to liia-wta 0.8336 56 309
3qfi-assembly1.cif.gz_A x-ray crystal structure of transcriptional regulator (ef0465) from enterococcus faecalis, northeast structural genomics consortium target efr190 0.8288 63 313
ID Description Score Start End Superfamily
3tepA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.8491 57 313 3.40.630.190
af_P52078_42_333_3.40.630.190 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.8467 62 316 3.40.630.190
af_O06347_65_357_3.40.630.190 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.8384 61 300 3.40.630.190
3qfiA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.8288 63 313 3.40.630.190
af_P96872_54_354_3.40.630.190 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.8256 61 308 3.40.630.190
ID Description Score Start End GO Terms
AF-A0A2E8Z3A4-F1-model_v4 Transcriptional regulator 0.9656 35 314
AF-A0A7K0WXZ8-F1-model_v4 LytR family transcriptional regulator 0.9505 54 318
AF-A0A2E8Z3A4-F1-model_v4 Transcriptional regulator 0.9423 35 314
AF-A0A7K0WXZ8-F1-model_v4 LytR family transcriptional regulator 0.9365 54 318
AF-A0A6L5FZG3-F1-model_v4 Cell envelope-related transcriptional attenuator domain-containing protein 0.9351 61 310

Map