F330855

General Info

Members Datasets Scaffolds Average Seq Length
219 149 188 218

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100302407|Ga0068853_1003024071
Length 253
Sequence LFILIFLPMCCPCGKALKTAAGKSADNKNQKQYFAEMKDEEIIHTTVSYVKKELLDAEGGHDWWHIERVWKNAKLIAANENVDLFVVELAALLHDIADSKFYDGDENIGPEKARHFLESISIEKEIIEHVENIMRNISFKGGNFTNDFFSKELAVVQDADRLDAIGAIGIARAFNYGGFKNREIYNPSIPPNFEMDKEDYKKSKAPSINHFYEKLLLLKNRMNTESGKKLAEERHQFMETFLKQFFLEWKGKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
6 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
7 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
8 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
9 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
10 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
11 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
12 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
13 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
14 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
15 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
16 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
17 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
18 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
19 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
20 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
21 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
22 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
23 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
24 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
25 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
26 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
27 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
85 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
86 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
87 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
110 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
137 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
138 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
139 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
140 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
141 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
142 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
143 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
144 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
145 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
146 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
147 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
148 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
149 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.84
Metatranscriptomes 0
Isolates 14.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.24
Nodule 0.46
Rhizoplane 0
Rhizosphere 72.15
Stem 0
Stem Tuber 0
Unclassified 14.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2379878 2162886007 Bacteria 1903
2 SwRhRL2b_contig_346326 2162886007 Bacteria 2294
3 JGI24739J22299_10019128 3300001989 Bacteria 2455
4 rootL2_10128197 3300003322 Bacteria 3573
5 rootH1_10312402 3300003323 Bacteria 3038
6 JGI25160J50197_1010599 3300003354 Bacteria 3319
7 Ga0055526_1015549 3300003771 Bacteria 3048
8 Ga0055528_1000898 3300003790 Bacteria 20056
9 Ga0055530_10001215 3300003791 Bacteria 19901
10 Ga0055531_10000237 3300003794 Bacteria 60479
11 Ga0065165_1000190 3300005262 Bacteria 107377
12 Ga0065165_1006699 3300005262 Bacteria 5929
13 Ga0065714_10101630 3300005288 Bacteria 1639
14 Ga0065704_10105327 3300005289 Bacteria 2114
15 Ga0065704_10189676 3300005289 Bacteria 1196
16 Ga0070658_10014803 3300005327 Bacteria 6251
17 Ga0070680_100051979 3300005336 Bacteria 3345
18 Ga0070710_10024561 3300005437 Bacteria 3181
19 Ga0070679_100029505 3300005530 Bacteria 5412
20 Ga0068853_100085900 3300005539 Bacteria 2759
21 Ga0068853_100302407 3300005539 Bacteria 1479
22 Ga0070686_100066205 3300005544 Bacteria 2349
23 Ga0070693_100021318 3300005547 Bacteria 3431
24 Ga0068855_100236361 3300005563 Bacteria 2044
25 Ga0068855_100336631 3300005563 Bacteria 1665
26 Ga0068856_100321209 3300005614 Bacteria 1565
27 Ga0068856_100517153 3300005614 Bacteria 1215
28 Ga0068852_100002801 3300005616 Bacteria 12083
29 Ga0081539_10005032 3300005985 Bacteria 13911
30 Ga0075366_10337802 3300006195 Bacteria 923
31 Ga0105240_10594825 3300009093 Bacteria 1219
32 Ga0105243_10000003 3300009148 Bacteria 712931
33 Ga0105237_10204511 3300009545 Bacteria 1975
34 Ga0105239_10172196 3300010375 Bacteria 2421
35 Ga0157373_10000023 3300013100 Bacteria 164200
36 Ga0157373_10032890 3300013100 Bacteria 3732
37 Ga0157373_10168781 3300013100 Bacteria 1540
38 Ga0157371_10060167 3300013102 Bacteria 2693
39 Ga0157371_10172432 3300013102 Bacteria 1546
40 Ga0157370_10001180 3300013104 Bacteria 32585
41 Ga0157370_10003941 3300013104 Bacteria 17275
42 Ga0157370_10004338 3300013104 Bacteria 16292
43 Ga0157370_10117824 3300013104 Bacteria 2481
44 Ga0157370_10393771 3300013104 Bacteria 1275
45 Ga0157370_10415035 3300013104 Bacteria 1239
46 Ga0157369_10158964 3300013105 Bacteria 2386
47 Ga0157369_10160611 3300013105 Bacteria 2372
48 Ga0163162_10200217 3300013306 Bacteria 2126
49 Ga0157372_10009404 3300013307 Bacteria 10396
50 Ga0157372_10057385 3300013307 Bacteria 4352
51 Ga0157372_10386729 3300013307 Bacteria 1630
52 Ga0157375_11325116 3300013308 Bacteria 847
53 Ga0157376_10172856 3300014969 Bacteria 1969
54 Ga0182006_1009664 3300015261 Bacteria 4316
55 Ga0182006_1018215 3300015261 Bacteria 2970
56 Ga0182006_1059204 3300015261 Bacteria 1451
57 Ga0209436_100555 3300025208 Bacteria 16161
58 Ga0209436_101721 3300025208 Bacteria 7204
59 Ga0209233_1008444 3300025261 Bacteria 3190
60 Ga0209673_1000403 3300025273 Bacteria 76872
61 Ga0209130_1002023 3300025284 Bacteria 11040
62 Ga0209564_1017260 3300025295 Bacteria 2824
63 Ga0209758_1008896 3300025297 Bacteria 6376
64 Ga0209050_1000136 3300025298 Bacteria 179113
65 Ga0207426_1000164 3300025302 Bacteria 171465
66 Ga0207426_1000543 3300025302 Bacteria 53486
67 Ga0209257_1000025 3300025304 Bacteria 724838
68 Ga0207692_10018234 3300025898 Bacteria 3147
69 Ga0207705_10029665 3300025909 Bacteria 3899
70 Ga0207654_10104852 3300025911 Bacteria 1748
71 Ga0207695_10428481 3300025913 Bacteria 1207
72 Ga0207657_10046237 3300025919 Unclassified 3814
73 Ga0207709_10000008 3300025935 Bacteria 713099
74 Ga0207691_10609269 3300025940 Bacteria 924
75 Ga0207661_10710729 3300025944 Bacteria 925
76 Ga0207667_10066740 3300025949 Bacteria 3749
77 Ga0207667_10198380 3300025949 Bacteria 2059
78 Ga0207667_10952262 3300025949 Bacteria 848
79 Ga0207639_10088459 3300026041 Bacteria 2472
80 Ga0207639_10214918 3300026041 Bacteria 1657
81 Ga0207698_10586352 3300026142 Bacteria 1097
82 Ga0209282_1002925 3300027666 Bacteria 10036
83 Ga0265323_10000008 3300028653 Unclassified 125564
84 Ga0265323_10017671 3300028653 Bacteria 2768
85 Ga0265322_10000013 3300028654 Unclassified 142527
86 Ga0265330_10001865 3300031235 Bacteria 11736
87 Ga0265328_10046050 3300031239 Unclassified 1604
88 Ga0265329_10000030 3300031242 Bacteria 58575
89 Ga0265327_10043550 3300031251 Unclassified 2400
90 Ga0265327_10048878 3300031251 Bacteria 2221
91 Ga0265316_10000242 3300031344 Bacteria 62720
92 Ga0265316_10008204 3300031344 Bacteria 9721
93 Ga0265342_10000143 3300031712 Bacteria 80610
94 Ga0307405_10000001 3300031731 Bacteria 1731270
95 Ga0307405_10003473 3300031731 Bacteria 7242
96 Ga0307413_10392739 3300031824 Bacteria 1084
97 Ga0307410_10041064 3300031852 Bacteria 3049
98 Ga0307406_10001003 3300031901 Bacteria 15676
99 Ga0307407_10157038 3300031903 Bacteria 1485
100 Ga0307409_100009692 3300031995 Bacteria 5938
101 Ga0307416_100000604 3300032002 Bacteria 18489
102 Ga0307416_100003918 3300032002 Bacteria 8862
103 Ga0307414_10003475 3300032004 Bacteria 8418
104 Ga0307414_10087961 3300032004 Bacteria 2298
105 Ga0307414_10214211 3300032004 Bacteria 1577
106 Ga0307414_10618935 3300032004 Bacteria 973
107 Ga0307411_10014402 3300032005 Bacteria 4398
108 Ga0307415_100040735 3300032126 Bacteria 3079
109 Ga0395899_0056521 3300037312 Bacteria 2900
110 Ga0395900_0070708 3300037418 Bacteria 3588
111 Ga0395900_0078048 3300037418 Viruses 3403
112 Ga0395898_0032883 3300037466 Unclassified 5178
113 Ga0395901_0086283 3300038443 Unclassified 3282
114 Ga0439466_0000467 3300041411 Bacteria 15400
115 Ga0451853_0785649 3300041512 Bacteria 1674
116 Ga0439449_0121839 3300042007 Bacteria 968
117 Ga0439457_026794 3300042014 Bacteria 1276
118 Ga0451577_0000279 3300042876 Bacteria 99236
119 Ga0451577_0089788 3300042876 Bacteria 2742
120 Ga0451577_0093422 3300042876 Bacteria 2686
121 Ga0451577_0127159 3300042876 Bacteria 2284
122 Ga0451577_0858871 3300042876 Bacteria 818
123 Ga0453683_0000031 3300044673 Bacteria 241998
124 Ga0453683_0002394 3300044673 Bacteria 14640
125 Ga0453683_0054855 3300044673 Bacteria 2494
126 Ga0453683_0103523 3300044673 Unclassified 1788
127 Ga0453683_0119425 3300044673 Bacteria 1659
128 Ga0453683_0278223 3300044673 Bacteria 1068
129 Ga0453683_0395693 3300044673 Bacteria 890
130 Ga0466961_0169610 3300044693 Bacteria 1358
131 Ga0453684_0000929 3300044712 Bacteria 96874
132 Ga0453684_0003682 3300044712 Bacteria 33986
133 Ga0453684_0005210 3300044712 Bacteria 26092
134 Ga0453684_0018367 3300044712 Bacteria 10738
135 Ga0453684_0020388 3300044712 Bacteria 10004
136 Ga0453684_0044264 3300044712 Bacteria 5962
137 Ga0453684_0082243 3300044712 Bacteria 4013
138 Ga0453684_0169560 3300044712 Bacteria 2574
139 Ga0453684_0344659 3300044712 Unclassified 1681
140 Ga0453684_0454209 3300044712 Bacteria 1426
141 Ga0453684_0855672 3300044712 Bacteria 977
142 Ga0466957_0002819 3300044842 Bacteria 9401
143 Ga0451576_0000414 3300045051 Bacteria 99196
144 Ga0451576_0002228 3300045051 Bacteria 29828
145 Ga0451576_0002986 3300045051 Bacteria 23954
146 Ga0451576_0009608 3300045051 Bacteria 11187
147 Ga0451576_0049873 3300045051 Bacteria 4392
148 Ga0451576_0050262 3300045051 Bacteria 4372
149 Ga0451576_0784652 3300045051 Bacteria 1000
150 Ga0495607_0027373 3300046501 Bacteria 3526
151 Ga0495632_0123898 3300046519 Bacteria 1206
152 Ga0495633_0000137 3300046558 Bacteria 96876
153 Ga0496116_0001177 3300048919 Bacteria 30743
154 Ga0496116_0001214 3300048919 Bacteria 30053
155 Ga0496116_0015352 3300048919 Bacteria 6057
156 Ga0496117_0010726 3300048920 Bacteria 8285
157 Ga0496118_0057718 3300048921 Bacteria 2907
158 Ga0496121_0000010 3300048924 Bacteria 793488
159 Ga0496121_0113368 3300048924 Bacteria 2063
160 Ga0496121_0293001 3300048924 Bacteria 1108
161 Ga0496122_0016505 3300048925 Bacteria 6980
162 Ga0496123_0013729 3300048926 Bacteria 6772
163 Ga0496124_0085546 3300048927 Bacteria 2584
164 Ga0496124_0269726 3300048927 Bacteria 1247
165 Ga0496125_0000098 3300048928 Bacteria 204522
166 Ga0496125_0109612 3300048928 Bacteria 2004
167 Ga0496126_0010401 3300048929 Bacteria 9757
168 Ga0496126_0046282 3300048929 Bacteria 3992
169 Ga0501034_0000002 3300049571 Bacteria 565510
170 Ga0501034_0000315 3300049571 Bacteria 85783
171 Ga0501034_0008097 3300049571 Bacteria 11150
172 Ga0501037_0166250 3300049573 Bacteria 1571
173 Ga0501047_0044836 3300049581 Bacteria 4274
174 Ga0501048_0481931 3300049582 Bacteria 889
175 Ga0501249_004321 3300049679 Bacteria 2883
176 Ga0501044_0261678 3300049823 Bacteria 1668
177 Ga0501044_0276834 3300049823 Bacteria 1613
178 Ga0501044_0460129 3300049823 Bacteria 1178
179 nmdc:mga0k408_134772_c1 3300050493 Bacteria 1467
180 Ga0500644_0001544 3300053088 Bacteria 6050
181 Ga0500646_0007363 3300053090 Bacteria 2811
182 Ga0500583_0054910 3300053092 Bacteria 1861
183 Ga0500651_0044669 3300053093 Bacteria 2789
184 Ga0500594_0111958 3300053118 Bacteria 850
185 Ga0500559_0006873 3300053136 Bacteria 5096
186 Ga0500589_000882 3300053147 Bacteria 7973
187 Ga0500633_0009040 3300053160 Bacteria 2600
188 Ga0500636_0024425 3300053177 Bacteria 3575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0054855 Ga0453683_0054855_1857_2402 181
2 3300044712 Ga0453684_0082243 Ga0453684_0082243_2585_3292 197
3 3300044712 Ga0453684_0454209 Ga0453684_0454209_190_804 200
4 3300003322 rootL2_10128197 rootL2_101281973 204
5 3300005336 Ga0070680_100051979 Ga0070680_1000519794 205
6 3300005530 Ga0070679_100029505 Ga0070679_1000295054 205
7 3300005616 Ga0068852_100002801 Ga0068852_1000028019 205
8 3300025909 Ga0207705_10029665 Ga0207705_100296653 205
9 3300025919 Ga0207657_10046237 Ga0207657_100462374 205
10 3300025944 Ga0207661_10710729 Ga0207661_107107291 205
11 3300053088 Ga0500644_0001544 Ga0500644_0001544_1181_1822 205
12 3300053136 Ga0500559_0006873 Ga0500559_0006873_3065_3706 205
13 3300053160 Ga0500633_0009040 Ga0500633_0009040_831_1472 205
14 3300053177 Ga0500636_0024425 Ga0500636_0024425_395_1036 205
15 3300044712 Ga0453684_0003682 Ga0453684_0003682_4869_5489 206
16 3300005262 Ga0065165_1006699 Ga0065165_10066994 207
17 3300013104 Ga0157370_10393771 Ga0157370_103937711 207
18 3300037418 Ga0395900_0078048 Ga0395900_0078048_2499_3134 207
19 3300037466 Ga0395898_0032883 Ga0395898_0032883_1690_2325 207
20 3300038443 Ga0395901_0086283 Ga0395901_0086283_1488_2123 207
21 3300025208 Ga0209436_101721 Ga0209436_1017214 208
22 3300028653 Ga0265323_10000008 Ga0265323_10000008102 208
23 3300028654 Ga0265322_10000013 Ga0265322_10000013124 208
24 3300031251 Ga0265327_10048878 Ga0265327_100488782 208
25 3300031344 Ga0265316_10008204 Ga0265316_1000820410 208
26 3300049573 Ga0501037_0166250 Ga0501037_0166250_32_697 208
27 3300049823 Ga0501044_0276834 Ga0501044_0276834_273_938 208
28 3300045051 Ga0451576_0002228 Ga0451576_0002228_25372_26037 209
29 iso_pu_bacteria 3006973921 3006975572 209
30 3300031251 Ga0265327_10043550 Ga0265327_100435502 210
31 3300037312 Ga0395899_0056521 Ga0395899_0056521_340_1038 210
32 iso_pu_bacteria 8036736890 8036739110 210
33 iso_pu_bacteria 2721755487 2722730833 211
34 iso_pu_bacteria 2881247448 2881248842 211
35 iso_pu_bacteria 2896344016 2896344269 211
36 iso_pu_bacteria 2904780799 2904783178 211
37 iso_pu_bacteria 2919177583 2919180786 211
38 iso_pu_bacteria 2965320100 2965321255 211
39 iso_pu_bacteria 3003233435 3003234940 211
40 iso_pu_bacteria 8055588893 8055590255 211
41 iso_pu_bacteria 2842903701 2842905057 212
42 3300044712 Ga0453684_0044264 Ga0453684_0044264_4897_5541 213
43 3300046519 Ga0495632_0123898 Ga0495632_0123898_462_1103 213
44 3300048924 Ga0496121_0000010 Ga0496121_0000010_708710_709354 213
45 3300049571 Ga0501034_0000315 Ga0501034_0000315_48531_49175 213
46 3300053090 Ga0500646_0007363 Ga0500646_0007363_1304_1945 213
47 3300053092 Ga0500583_0054910 Ga0500583_0054910_109_750 213
48 3300053147 Ga0500589_000882 Ga0500589_000882_3279_3920 213
49 iso_pu_bacteria 2513020052 2513234585 213
50 iso_pu_bacteria 2519899754 2520880378 213
51 iso_pu_bacteria 2643221600 2644012234 213
52 iso_pu_bacteria 2643221716 2644641514 213
53 iso_pu_bacteria 2643221725 2644682377 213
54 iso_pu_bacteria 2739367857 2740000465 213
55 iso_pu_bacteria 2739367858 2740005281 213
56 iso_pu_bacteria 2802428842 2802651148 213
57 iso_pu_bacteria 2816332280 2817414037 213
58 iso_pu_bacteria 2833640130 2833641530 213
59 iso_pu_bacteria 2839989709 2839991515 213
60 iso_pu_bacteria 2903895155 2903896557 213
61 iso_pu_bacteria 2919191525 2919195820 213
62 iso_pu_bacteria 2929154850 2929159203 213
63 iso_pu_bacteria 2946013367 2946015279 213
64 iso_pu_bacteria 2958458903 2958461771 213
65 iso_pu_bacteria 2977268062 2977272562 213
66 iso_pu_bacteria 8054307821 8054310970 213
67 iso_pu_bacteria 8055592153 8055593090 213
68 iso_pu_bacteria 8056440228 8056442788 213
69 3300005547 Ga0070693_100021318 Ga0070693_1000213183 214
70 3300013307 Ga0157372_10057385 Ga0157372_100573853 214
71 3300031731 Ga0307405_10003473 Ga0307405_100034737 214
72 3300032004 Ga0307414_10618935 Ga0307414_106189352 214
73 3300042876 Ga0451577_0000279 Ga0451577_0000279_17998_18693 214
74 3300044673 Ga0453683_0103523 Ga0453683_0103523_542_1237 214
75 3300044712 Ga0453684_0000929 Ga0453684_0000929_17998_18693 214
76 3300045051 Ga0451576_0000414 Ga0451576_0000414_17998_18693 214
77 2162886007 SwRhRL2b_contig_346326 SwRhRL2b_0075.00006920 215
78 3300005289 Ga0065704_10189676 Ga0065704_101896761 215
79 3300005985 Ga0081539_10005032 Ga0081539_100050324 215
80 3300009148 Ga0105243_10000003 Ga0105243_10000003314 215
81 3300025935 Ga0207709_10000008 Ga0207709_10000008260 215
82 3300032004 Ga0307414_10003475 Ga0307414_100034756 215
83 3300032004 Ga0307414_10087961 Ga0307414_100879611 215
84 3300042876 Ga0451577_0089788 Ga0451577_0089788_457_1107 215
85 3300042876 Ga0451577_0093422 Ga0451577_0093422_987_1643 215
86 3300044673 Ga0453683_0119425 Ga0453683_0119425_502_1152 215
87 3300044673 Ga0453683_0278223 Ga0453683_0278223_134_814 215
88 3300044673 Ga0453683_0395693 Ga0453683_0395693_91_741 215
89 3300044712 Ga0453684_0169560 Ga0453684_0169560_644_1294 215
90 3300044712 Ga0453684_0344659 Ga0453684_0344659_871_1548 215
91 3300045051 Ga0451576_0002986 Ga0451576_0002986_23156_23836 215
92 3300045051 Ga0451576_0049873 Ga0451576_0049873_3699_4379 215
93 3300045051 Ga0451576_0784652 Ga0451576_0784652_240_890 215
94 3300046558 Ga0495633_0000137 Ga0495633_0000137_94660_95313 215
95 3300048919 Ga0496116_0015352 Ga0496116_0015352_5150_5797 215
96 3300048920 Ga0496117_0010726 Ga0496117_0010726_3183_3830 215
97 3300048921 Ga0496118_0057718 Ga0496118_0057718_900_1547 215
98 3300048926 Ga0496123_0013729 Ga0496123_0013729_4919_5566 215
99 3300048927 Ga0496124_0085546 Ga0496124_0085546_1476_2123 215
100 3300048928 Ga0496125_0109612 Ga0496125_0109612_749_1396 215
101 3300049571 Ga0501034_0000002 Ga0501034_0000002_424097_424750 215
102 3300053093 Ga0500651_0044669 Ga0500651_0044669_1738_2391 215
103 2162886007 SwRhRL2b_contig_2379878 SwRhRL2b_0274.00003600 216
104 3300001989 JGI24739J22299_10019128 JGI24739J22299_100191283 216
105 3300003323 rootH1_10312402 rootH1_103124023 216
106 3300003354 JGI25160J50197_1010599 JGI25160J50197_10105991 216
107 3300003771 Ga0055526_1015549 Ga0055526_10155492 216
108 3300003790 Ga0055528_1000898 Ga0055528_10008983 216
109 3300003791 Ga0055530_10001215 Ga0055530_100012159 216
110 3300003794 Ga0055531_10000237 Ga0055531_1000023735 216
111 3300005262 Ga0065165_1000190 Ga0065165_100019020 216
112 3300005288 Ga0065714_10101630 Ga0065714_101016303 216
113 3300005289 Ga0065704_10105327 Ga0065704_101053273 216
114 3300005327 Ga0070658_10014803 Ga0070658_100148035 216
115 3300005437 Ga0070710_10024561 Ga0070710_100245612 216
116 3300005539 Ga0068853_100085900 Ga0068853_1000859003 216
117 3300005539 Ga0068853_100302407 Ga0068853_1003024071 216
118 3300005544 Ga0070686_100066205 Ga0070686_1000662052 216
119 3300005563 Ga0068855_100236361 Ga0068855_1002363611 216
120 3300005563 Ga0068855_100336631 Ga0068855_1003366312 216
121 3300005614 Ga0068856_100321209 Ga0068856_1003212091 216
122 3300005614 Ga0068856_100517153 Ga0068856_1005171532 216
123 3300006195 Ga0075366_10337802 Ga0075366_103378021 216
124 3300009093 Ga0105240_10594825 Ga0105240_105948252 216
125 3300009545 Ga0105237_10204511 Ga0105237_102045111 216
126 3300010375 Ga0105239_10172196 Ga0105239_101721962 216
127 3300013100 Ga0157373_10000023 Ga0157373_1000002314 216
128 3300013100 Ga0157373_10032890 Ga0157373_100328902 216
129 3300013100 Ga0157373_10168781 Ga0157373_101687812 216
130 3300013102 Ga0157371_10060167 Ga0157371_100601673 216
131 3300013102 Ga0157371_10172432 Ga0157371_101724322 216
132 3300013104 Ga0157370_10001180 Ga0157370_1000118012 216
133 3300013104 Ga0157370_10003941 Ga0157370_100039415 216
134 3300013104 Ga0157370_10004338 Ga0157370_100043383 216
135 3300013104 Ga0157370_10117824 Ga0157370_101178242 216
136 3300013104 Ga0157370_10415035 Ga0157370_104150352 216
137 3300013105 Ga0157369_10158964 Ga0157369_101589642 216
138 3300013105 Ga0157369_10160611 Ga0157369_101606111 216
139 3300013306 Ga0163162_10200217 Ga0163162_102002172 216
140 3300013307 Ga0157372_10009404 Ga0157372_100094042 216
141 3300013307 Ga0157372_10386729 Ga0157372_103867292 216
142 3300013308 Ga0157375_11325116 Ga0157375_113251161 216
143 3300014969 Ga0157376_10172856 Ga0157376_101728562 216
144 3300015261 Ga0182006_1009664 Ga0182006_10096644 216
145 3300015261 Ga0182006_1018215 Ga0182006_10182152 216
146 3300015261 Ga0182006_1059204 Ga0182006_10592043 216
147 3300025208 Ga0209436_100555 Ga0209436_1005555 216
148 3300025261 Ga0209233_1008444 Ga0209233_10084443 216
149 3300025273 Ga0209673_1000403 Ga0209673_100040354 216
150 3300025284 Ga0209130_1002023 Ga0209130_100202310 216
151 3300025295 Ga0209564_1017260 Ga0209564_10172602 216
152 3300025297 Ga0209758_1008896 Ga0209758_10088964 216
153 3300025298 Ga0209050_1000136 Ga0209050_1000136101 216
154 3300025302 Ga0207426_1000164 Ga0207426_100016449 216
155 3300025302 Ga0207426_1000543 Ga0207426_100054319 216
156 3300025304 Ga0209257_1000025 Ga0209257_1000025551 216
157 3300025898 Ga0207692_10018234 Ga0207692_100182342 216
158 3300025911 Ga0207654_10104852 Ga0207654_101048522 216
159 3300025913 Ga0207695_10428481 Ga0207695_104284812 216
160 3300025940 Ga0207691_10609269 Ga0207691_106092691 216
161 3300025949 Ga0207667_10066740 Ga0207667_100667405 216
162 3300025949 Ga0207667_10198380 Ga0207667_101983801 216
163 3300025949 Ga0207667_10952262 Ga0207667_109522622 216
164 3300026041 Ga0207639_10088459 Ga0207639_100884592 216
165 3300026041 Ga0207639_10214918 Ga0207639_102149182 216
166 3300026142 Ga0207698_10586352 Ga0207698_105863522 216
167 3300027666 Ga0209282_1002925 Ga0209282_100292510 216
168 3300028653 Ga0265323_10017671 Ga0265323_100176712 216
169 3300031235 Ga0265330_10001865 Ga0265330_100018653 216
170 3300031239 Ga0265328_10046050 Ga0265328_100460502 216
171 3300031242 Ga0265329_10000030 Ga0265329_1000003035 216
172 3300031344 Ga0265316_10000242 Ga0265316_1000024214 216
173 3300031712 Ga0265342_10000143 Ga0265342_1000014357 216
174 3300031731 Ga0307405_10000001 Ga0307405_1000000164 216
175 3300031824 Ga0307413_10392739 Ga0307413_103927391 216
176 3300031852 Ga0307410_10041064 Ga0307410_100410643 216
177 3300031901 Ga0307406_10001003 Ga0307406_100010033 216
178 3300031903 Ga0307407_10157038 Ga0307407_101570382 216
179 3300031995 Ga0307409_100009692 Ga0307409_1000096925 216
180 3300032002 Ga0307416_100000604 Ga0307416_10000060410 216
181 3300032002 Ga0307416_100003918 Ga0307416_1000039189 216
182 3300032004 Ga0307414_10214211 Ga0307414_102142112 216
183 3300032005 Ga0307411_10014402 Ga0307411_100144023 216
184 3300032126 Ga0307415_100040735 Ga0307415_1000407353 216
185 3300037418 Ga0395900_0070708 Ga0395900_0070708_2071_2754 216
186 3300041411 Ga0439466_0000467 Ga0439466_0000467_10262_10915 216
187 3300041512 Ga0451853_0785649 Ga0451853_0785649_477_1130 216
188 3300042007 Ga0439449_0121839 Ga0439449_0121839_129_797 216
189 3300042014 Ga0439457_026794 Ga0439457_026794_273_941 216
190 3300042876 Ga0451577_0127159 Ga0451577_0127159_1040_1702 216
191 3300042876 Ga0451577_0858871 Ga0451577_0858871_14_667 216
192 3300044673 Ga0453683_0000031 Ga0453683_0000031_220813_221475 216
193 3300044673 Ga0453683_0002394 Ga0453683_0002394_7950_8612 216
194 3300044693 Ga0466961_0169610 Ga0466961_0169610_261_914 216
195 3300044712 Ga0453684_0005210 Ga0453684_0005210_24731_25390 216
196 3300044712 Ga0453684_0018367 Ga0453684_0018367_6578_7240 216
197 3300044712 Ga0453684_0020388 Ga0453684_0020388_9082_9747 216
198 3300044712 Ga0453684_0855672 Ga0453684_0855672_16_669 216
199 3300044842 Ga0466957_0002819 Ga0466957_0002819_5629_6282 216
200 3300045051 Ga0451576_0009608 Ga0451576_0009608_2484_3137 216
201 3300045051 Ga0451576_0050262 Ga0451576_0050262_1173_1835 216
202 3300046501 Ga0495607_0027373 Ga0495607_0027373_1132_1785 216
203 3300048919 Ga0496116_0001177 Ga0496116_0001177_17262_18062 216
204 3300048919 Ga0496116_0001214 Ga0496116_0001214_19639_20292 216
205 3300048924 Ga0496121_0113368 Ga0496121_0113368_322_975 216
206 3300048924 Ga0496121_0293001 Ga0496121_0293001_138_788 216
207 3300048925 Ga0496122_0016505 Ga0496122_0016505_699_1499 216
208 3300048927 Ga0496124_0269726 Ga0496124_0269726_347_1000 216
209 3300048928 Ga0496125_0000098 Ga0496125_0000098_18101_18754 216
210 3300048929 Ga0496126_0010401 Ga0496126_0010401_8523_9176 216
211 3300048929 Ga0496126_0046282 Ga0496126_0046282_2714_3514 216
212 3300049571 Ga0501034_0008097 Ga0501034_0008097_4440_5093 216
213 3300049581 Ga0501047_0044836 Ga0501047_0044836_253_906 216
214 3300049582 Ga0501048_0481931 Ga0501048_0481931_95_745 216
215 3300049679 Ga0501249_004321 Ga0501249_004321_1703_2356 216
216 3300049823 Ga0501044_0261678 Ga0501044_0261678_900_1553 216
217 3300049823 Ga0501044_0460129 Ga0501044_0460129_107_760 216
218 3300050493 nmdc:mga0k408_134772_c1 nmdc:mga0k408_134772_c1_245_910 216
219 3300053118 Ga0500594_0111958 Ga0500594_0111958_36_698 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

63

165

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3djb-assembly1.cif.gz_B crystal structure of a hd-superfamily hydrolase (bt9727_1981) from bacillus thuringiensis, northeast structural genomics consortium target bur114 0.947 1 213
3djb-assembly1.cif.gz_B crystal structure of a hd-superfamily hydrolase (bt9727_1981) from bacillus thuringiensis, northeast structural genomics consortium target bur114 0.9323 1 213
3dto-assembly1.cif.gz_B crystal structure of the metal-dependent hd domain-containing hydrolase bh2835 from bacillus halodurans, northeast structural genomics consortium target bhr130. 0.9282 1 211
5dqw-assembly1.cif.gz_A the crystal structure of bacillus subtilis ypgq in complex with adp 0.9165 6 208
5ihy-assembly1.cif.gz_A the crystal structure of bacillus subtilis semet-ypgq 0.9105 6 208
ID Description Score Start End Superfamily
3djbB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9505 113 208 1.20.58.1910
af_Q8GUM8_114_222_1.20.58.1910 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9399 113 216 1.20.58.1910
af_C6T179_106_223_1.20.58.1910 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9399 113 214 1.20.58.1910
3dtoB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9395 112 211 1.20.58.1910
3b57A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9117 113 213 1.20.58.1910
ID Description Score Start End GO Terms
AF-A0A4Q6DJ83-F1-model_v4 deleted 1.001 129 216
AF-A0A7Y2J7H0-F1-model_v4 Phosphohydrolase 1 124 214 GO:0016787
AF-A0A3D6BWB9-F1-model_v4 Phosphohydrolase 0.9911 140 210 GO:0016787
AF-A0A4Q6DJ83-F1-model_v4 deleted 0.9899 129 216
AF-A0A495MMZ4-F1-model_v4 HD/PDEase domain-containing protein 0.9869 1 216

Feature Viewer

pLDDT pTM Quality
90.21 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map