F330647

General Info

Members Datasets Scaffolds Average Seq Length
219 153 207 192

Family's Representative Sequence

Representative Sequence 3300004625|Ga0055543_1006987|Ga0055543_10069873
Length 211
Sequence MVDPNAYGCEASRMTLPRTEALIRCPWGEGDALLRDYHDREWGVPERDSRKLWEKLVLDGFQAGLSWRTILARRDGFRRAFDGFDPERVAAYGDGDVARLLADTGIIRSRSKIAASIRNARAFLAMRETGEDFATFAWRFVGGRPIEWEGPVPPNSPLSEQVSKALRKRGFTFVGPTIVFAWMEATGLINSHAPDCFRRHQVGCNPLDKKA

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
3 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
4 2734482264 Dyella sp. AD052 Isolate Unclassified
5 2738543009 Luteibacter sp. OK325 Isolate Unclassified
6 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
7 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
8 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
9 2919085039 Luteibacter sp. 1214 Isolate Unclassified
10 2919404418 Luteibacter sp. 3190 Isolate Unclassified
11 2941471342 Luteibacter sp. 621 Isolate Unclassified
12 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
77 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
78 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
79 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
80 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
81 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
111 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
112 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
113 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
114 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
124 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
143 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
144 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
145 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
146 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
147 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
148 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
151 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
152 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
153 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.61
Metatranscriptomes 0.91
Isolates 5.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.33
Nodule 0
Rhizoplane 2.74
Rhizosphere 67.58
Stem 0
Stem Tuber 0
Unclassified 17.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10004646 3300002075 Bacteria 3348
2 JGI25162J39368_1012811 3300002737 Bacteria 949
3 rootH1_10012010 3300003323 Bacteria 1432
4 JGI25407J50210_10019528 3300003373 Bacteria 1762
5 Ga0006562J51391_1043309 3300003578 Bacteria 4190
6 Ga0006562J51391_1043311 3300003578 Bacteria 7980
7 Ga0055540_1017511 3300003792 Bacteria 1997
8 Ga0055540_1037342 3300003792 Bacteria 1071
9 Ga0055543_1006987 3300004625 Bacteria 2660
10 Ga0065165_1000949 3300005262 Bacteria 36709
11 Ga0065165_1016503 3300005262 Bacteria 2762
12 Ga0070658_10277625 3300005327 Unclassified 1426
13 Ga0070670_100053951 3300005331 Bacteria 3451
14 Ga0070666_10178288 3300005335 Bacteria 1490
15 Ga0070661_100141887 3300005344 Bacteria 1811
16 Ga0070699_100038838 3300005518 Bacteria 4121
17 Ga0070696_100001478 3300005546 Bacteria 15381
18 Ga0070693_100549773 3300005547 Bacteria 826
19 Ga0070665_100087360 3300005548 Bacteria 3123
20 Ga0068856_101044412 3300005614 Bacteria 835
21 Ga0068861_100353995 3300005719 Bacteria 1289
22 Ga0081538_10000356 3300005981 Bacteria 52018
23 Ga0075369_10024856 3300006186 Bacteria 2486
24 Ga0075428_100732902 3300006844 Bacteria 1052
25 Ga0075430_100027379 3300006846 Bacteria 4843
26 Ga0075431_100088046 3300006847 Bacteria 3204
27 Ga0075429_100089496 3300006880 Bacteria 2683
28 Ga0114129_10175924 3300009147 Bacteria 2915
29 Ga0105243_10762966 3300009148 Bacteria 949
30 Ga0105241_10440007 3300009174 Bacteria 1151
31 Ga0157370_10000076 3300013104 Bacteria 107887
32 Ga0157370_10015413 3300013104 Bacteria 7768
33 Ga0157369_10048446 3300013105 Bacteria 4611
34 Ga0182008_10007487 3300014497 Bacteria 6024
35 Ga0182008_10026225 3300014497 Bacteria 2955
36 Ga0182006_1000082 3300015261 Bacteria 119023
37 Ga0182006_1000161 3300015261 Bacteria 71421
38 Ga0182007_10025909 3300015262 Bacteria 2038
39 Ga0182007_10072893 3300015262 Bacteria 1125
40 Ga0182005_1000015 3300015265 Bacteria 387565
41 Ga0182005_1002385 3300015265 Bacteria 6761
42 Ga0182005_1009919 3300015265 Bacteria 2752
43 Ga0182005_1020018 3300015265 Bacteria 1842
44 Ga0163161_10004876 3300017792 Bacteria 9346
45 Ga0163161_10073005 3300017792 Bacteria 2513
46 Ga0209674_100488 3300025226 Bacteria 16850
47 Ga0209437_101084 3300025233 Bacteria 8725
48 Ga0209148_1001683 3300025254 Bacteria 9898
49 Ga0209129_1001339 3300025258 Bacteria 13929
50 Ga0209051_1003227 3300025303 Bacteria 10855
51 Ga0209051_1006648 3300025303 Bacteria 6475
52 Ga0209257_1018933 3300025304 Bacteria 2619
53 Ga0207710_10008673 3300025900 Bacteria 4287
54 Ga0207680_10014230 3300025903 Bacteria 4110
55 Ga0207647_10000005 3300025904 Bacteria 223490
56 Ga0207699_10148354 3300025906 Bacteria 1549
57 Ga0207649_10300266 3300025920 Bacteria 1174
58 Ga0207661_10260799 3300025944 Bacteria 1544
59 Ga0207712_10025388 3300025961 Bacteria 3936
60 Ga0207668_10078899 3300025972 Bacteria 2379
61 Ga0207658_10003106 3300025986 Bacteria 11882
62 Ga0207658_10550044 3300025986 Bacteria 1033
63 Ga0207683_10034356 3300026121 Bacteria 4407
64 Ga0209981_1000096 3300027378 Bacteria 9768
65 Ga0209999_1009788 3300027543 Bacteria 1730
66 Ga0209983_1001376 3300027665 Bacteria 5418
67 Ga0268266_10014276 3300028379 Bacteria 6831
68 Ga0268266_10122744 3300028379 Bacteria 2313
69 Ga0268265_10003748 3300028380 Bacteria 10807
70 Ga0268265_11497078 3300028380 Bacteria 678
71 Ga0268264_10055091 3300028381 Bacteria 3323
72 Ga0307511_10020097 3300030521 Bacteria 6335
73 Ga0265316_10437276 3300031344 Bacteria 939
74 Ga0307412_10001003 3300031911 Bacteria 16132
75 Ga0307411_10481782 3300032005 Bacteria 1045
76 Ga0307510_10200374 3300033180 Bacteria 1532
77 Ga0373931_0466529 3300035691 Bacteria 810
78 Ga0436365_0258677 3300039437 Bacteria 1089
79 Ga0439436_0000023 3300041404 Bacteria 58899
80 Ga0439461_0017273 3300041410 Bacteria 1401
81 Ga0439465_0002355 3300041413 Bacteria 6204
82 Ga0451795_0310429 3300041456 Bacteria 1310
83 Ga0439446_0135687 3300042156 Bacteria 801
84 Ga0450908_000069 3300042184 Bacteria 20399
85 Ga0451577_0073564 3300042876 Bacteria 3049
86 Ga0451576_0292795 3300045051 Bacteria 1702
87 Ga0495617_000040 3300046452 Bacteria 126637
88 Ga0495617_000172 3300046452 Bacteria 40798
89 Ga0495590_0006998 3300046457 Bacteria 4374
90 Ga0495638_0000251 3300046460 Bacteria 73147
91 Ga0495638_0143529 3300046460 Bacteria 1391
92 Ga0495650_0003035 3300046471 Bacteria 12672
93 Ga0495650_0012126 3300046471 Bacteria 4661
94 Ga0495584_0006411 3300046491 Bacteria 6158
95 Ga0495585_0000024 3300046492 Bacteria 148384
96 Ga0495585_0001053 3300046492 Bacteria 22816
97 Ga0495607_0000034 3300046501 Bacteria 147547
98 Ga0495607_0000220 3300046501 Bacteria 60900
99 Ga0495607_0003784 3300046501 Bacteria 11434
100 Ga0495583_0047779 3300046506 Bacteria 1966
101 Ga0495606_0000572 3300046507 Bacteria 58413
102 Ga0495606_0001013 3300046507 Bacteria 40827
103 Ga0495606_0003142 3300046507 Bacteria 17900
104 Ga0495610_0001255 3300046512 Bacteria 22785
105 Ga0495610_0020582 3300046512 Bacteria 3660
106 Ga0495610_0106088 3300046512 Bacteria 1251
107 Ga0495616_0000090 3300046513 Bacteria 76632
108 Ga0495616_0008073 3300046513 Bacteria 6267
109 Ga0495620_0000117 3300046515 Bacteria 63752
110 Ga0495620_0003663 3300046515 Bacteria 8771
111 Ga0495631_0000049 3300046518 Bacteria 72261
112 Ga0495631_0000130 3300046518 Bacteria 50580
113 Ga0495632_0000005 3300046519 Bacteria 362872
114 Ga0495632_0003909 3300046519 Bacteria 10356
115 Ga0495632_0025968 3300046519 Bacteria 3090
116 Ga0495632_0041002 3300046519 Bacteria 2328
117 Ga0495637_0005604 3300046520 Bacteria 6375
118 Ga0495643_0135264 3300046522 Bacteria 1234
119 Ga0495648_0000449 3300046524 Bacteria 44521
120 Ga0495648_0004692 3300046524 Bacteria 11588
121 Ga0495609_0003722 3300046538 Bacteria 8612
122 Ga0495668_0008983 3300046616 Bacteria 6171
123 Ga0495668_0031396 3300046616 Bacteria 2994
124 Ga0495668_0073166 3300046616 Bacteria 1883
125 Ga0495668_0274742 3300046616 Bacteria 923
126 Ga0495634_0255971 3300046642 Bacteria 1069
127 Ga0495611_0000005 3300046648 Bacteria 284271
128 Ga0495611_0000054 3300046648 Bacteria 81818
129 Ga0495625_0000066 3300046660 Bacteria 172144
130 Ga0495625_0033385 3300046660 Bacteria 3806
131 Ga0495625_0057361 3300046660 Bacteria 2769
132 Ga0495625_0724697 3300046660 Bacteria 585
133 Ga0495661_0000383 3300046665 Bacteria 47361
134 Ga0495661_0045421 3300046665 Bacteria 2687
135 Ga0495670_0002940 3300046691 Bacteria 8398
136 Ga0495670_0003944 3300046691 Bacteria 7283
137 Ga0495670_0029952 3300046691 Bacteria 2703
138 Ga0495671_0002031 3300046692 Bacteria 12961
139 Ga0495649_0010627 3300046694 Bacteria 5423
140 Ga0495589_0000026 3300046794 Bacteria 184723
141 Ga0495660_0000099 3300046810 Bacteria 93495
142 Ga0495660_0000277 3300046810 Bacteria 47885
143 Ga0495683_0000385 3300047323 Bacteria 35791
144 Ga0495679_000010 3300047446 Bacteria 337760
145 Ga0495673_0000038 3300047469 Bacteria 303785
146 Ga0495673_0000045 3300047469 Bacteria 280765
147 Ga0495673_0000212 3300047469 Bacteria 86904
148 Ga0495686_0000050 3300047472 Bacteria 269010
149 Ga0495686_0000320 3300047472 Bacteria 79875
150 Ga0495686_0002503 3300047472 Bacteria 17249
151 Ga0495686_0003348 3300047472 Bacteria 13979
152 Ga0495686_0034268 3300047472 Bacteria 3271
153 Ga0495686_0086091 3300047472 Bacteria 1912
154 Ga0496100_0007558 3300048903 Bacteria 6004
155 Ga0496101_0016569 3300048904 Bacteria 4982
156 Ga0496106_0008563 3300048909 Bacteria 7569
157 Ga0496106_0114871 3300048909 Bacteria 2099
158 Ga0496108_0795666 3300048911 Bacteria 816
159 Ga0496116_0099134 3300048919 Bacteria 1746
160 Ga0496117_0022088 3300048920 Bacteria 5113
161 Ga0496117_0210954 3300048920 Bacteria 1089
162 Ga0496118_0000815 3300048921 Bacteria 49685
163 Ga0496118_0002713 3300048921 Bacteria 23338
164 Ga0496118_0164022 3300048921 Bacteria 1369
165 Ga0496119_0011034 3300048922 Bacteria 7534
166 Ga0496119_0192860 3300048922 Bacteria 1060
167 Ga0496120_0008579 3300048923 Bacteria 7396
168 Ga0496120_0106689 3300048923 Bacteria 1470
169 Ga0496121_0001099 3300048924 Bacteria 47710
170 Ga0496121_0001168 3300048924 Bacteria 46072
171 Ga0496121_0001773 3300048924 Bacteria 35057
172 Ga0496121_0121444 3300048924 Bacteria 1972
173 Ga0496122_0022731 3300048925 Bacteria 5562
174 Ga0496122_0061022 3300048925 Bacteria 2771
175 Ga0496122_0104376 3300048925 Bacteria 1883
176 Ga0496122_0206107 3300048925 Bacteria 1144
177 Ga0496123_0013555 3300048926 Bacteria 6827
178 Ga0496124_0000760 3300048927 Bacteria 52655
179 Ga0496125_0023955 3300048928 Bacteria 5625
180 Ga0496126_0013640 3300048929 Bacteria 8249
181 Ga0496126_0069901 3300048929 Bacteria 3130
182 Ga0495678_000235 3300049459 Bacteria 62984
183 Ga0495682_0002327 3300049460 Bacteria 9039
184 Ga0501041_0213902 3300049577 Bacteria 1209
185 Ga0501043_0240179 3300049579 Bacteria 1397
186 Ga0501048_0106148 3300049582 Bacteria 1982
187 Ga0501070_0588955 3300049586 Bacteria 887
188 Ga0501074_0006874 3300049590 Bacteria 8217
189 Ga0501074_0231300 3300049590 Bacteria 1316
190 Ga0501035_0091425 3300049822 Bacteria 2679
191 nmdc:mga09592_587981_c1 3300050508 Bacteria 954
192 nmdc:mga09592_84564_c1 3300050508 Bacteria 2705
193 nmdc:mga0qj67_35610_c1 3300050509 Bacteria 3893
194 nmdc:mga06r32_23900_c1 3300050510 Bacteria 5664
195 nmdc:mga0sz30_445944_c1 3300050516 Bacteria 581
196 Ga0500643_000126 3300053087 Bacteria 78711
197 Ga0500647_0189895 3300053091 Bacteria 938
198 Ga0500566_0118649 3300053094 Bacteria 1429
199 Ga0500555_000469 3300053103 Bacteria 16735
200 Ga0500595_006707 3300053119 Bacteria 4857
201 Ga0500652_176451 3300053131 Bacteria 877
202 Ga0500658_0121484 3300053134 Bacteria 1158
203 Ga0500624_009192 3300053157 Bacteria 1400
204 Ga0500627_0068225 3300053158 Bacteria 1572
205 Ga0500633_0002709 3300053160 Bacteria 3706
206 Ga0500645_001047 3300053730 Bacteria 15393
207 Ga0500645_003415 3300053730 Bacteria 6456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041410 Ga0439461_0017273 Ga0439461_0017273_263_763 160
2 3300042156 Ga0439446_0135687 Ga0439446_0135687_261_761 160
3 3300048922 Ga0496119_0011034 Ga0496119_0011034_534_1124 161
4 3300005548 Ga0070665_100087360 Ga0070665_1000873605 165
5 3300025944 Ga0207661_10260799 Ga0207661_102607992 165
6 3300025986 Ga0207658_10550044 Ga0207658_105500442 165
7 3300026121 Ga0207683_10034356 Ga0207683_100343562 165
8 3300033180 Ga0307510_10200374 Ga0307510_102003742 169
9 3300046660 Ga0495625_0724697 Ga0495625_0724697_39_557 169
10 3300049579 Ga0501043_0240179 Ga0501043_0240179_131_643 169
11 3300053094 Ga0500566_0118649 Ga0500566_0118649_576_1136 171
12 iso_pu_bacteria 2919404418 2919406937 174
13 3300027378 Ga0209981_1000096 Ga0209981_10000964 175
14 3300027543 Ga0209999_1009788 Ga0209999_10097882 175
15 3300027665 Ga0209983_1001376 Ga0209983_10013764 175
16 3300046616 Ga0495668_0073166 Ga0495668_0073166_812_1366 175
17 3300046616 Ga0495668_0274742 Ga0495668_0274742_339_893 175
18 3300046642 Ga0495634_0255971 Ga0495634_0255971_402_956 177
19 3300003578 Ga0006562J51391_1043311 Ga0006562J51391_10433112 178
20 3300006186 Ga0075369_10024856 Ga0075369_100248564 178
21 3300025258 Ga0209129_1001339 Ga0209129_100133912 178
22 3300041413 Ga0439465_0002355 Ga0439465_0002355_4062_4598 178
23 3300046506 Ga0495583_0047779 Ga0495583_0047779_1392_1928 178
24 3300046512 Ga0495610_0106088 Ga0495610_0106088_31_567 178
25 3300048919 Ga0496116_0099134 Ga0496116_0099134_867_1403 178
26 3300048925 Ga0496122_0104376 Ga0496122_0104376_1319_1855 178
27 3300049590 Ga0501074_0006874 Ga0501074_0006874_7260_7811 178
28 3300050516 nmdc:mga0sz30_445944_c1 nmdc:mga0sz30_445944_c1_23_559 178
29 3300053131 Ga0500652_176451 Ga0500652_176451_302_838 178
30 iso_pu_bacteria 2842914999 2842916942 179
31 3300003373 JGI25407J50210_10019528 JGI25407J50210_100195282 180
32 3300005981 Ga0081538_10000356 Ga0081538_1000035644 180
33 3300042876 Ga0451577_0073564 Ga0451577_0073564_399_962 181
34 3300045051 Ga0451576_0292795 Ga0451576_0292795_252_815 181
35 3300049577 Ga0501041_0213902 Ga0501041_0213902_322_903 182
36 3300053091 Ga0500647_0189895 Ga0500647_0189895_80_631 182
37 3300005331 Ga0070670_100053951 Ga0070670_1000539513 183
38 3300006844 Ga0075428_100732902 Ga0075428_1007329022 183
39 3300025906 Ga0207699_10148354 Ga0207699_101483541 183
40 3300048925 Ga0496122_0061022 Ga0496122_0061022_109_660 183
41 3300005262 Ga0065165_1016503 Ga0065165_10165033 184
42 3300005335 Ga0070666_10178288 Ga0070666_101782882 184
43 3300005614 Ga0068856_101044412 Ga0068856_1010444122 184
44 3300005719 Ga0068861_100353995 Ga0068861_1003539951 184
45 3300006846 Ga0075430_100027379 Ga0075430_1000273793 184
46 3300006847 Ga0075431_100088046 Ga0075431_1000880462 184
47 3300006880 Ga0075429_100089496 Ga0075429_1000894962 184
48 3300025903 Ga0207680_10014230 Ga0207680_100142302 184
49 3300025961 Ga0207712_10025388 Ga0207712_100253883 184
50 3300025972 Ga0207668_10078899 Ga0207668_100788992 184
51 3300025986 Ga0207658_10003106 Ga0207658_1000310612 184
52 3300028379 Ga0268266_10014276 Ga0268266_100142762 184
53 3300028379 Ga0268266_10122744 Ga0268266_101227441 184
54 3300028380 Ga0268265_10003748 Ga0268265_1000374810 184
55 3300028381 Ga0268264_10055091 Ga0268264_100550912 184
56 3300030521 Ga0307511_10020097 Ga0307511_100200973 184
57 3300031344 Ga0265316_10437276 Ga0265316_104372762 184
58 3300032005 Ga0307411_10481782 Ga0307411_104817822 184
59 3300039437 Ga0436365_0258677 Ga0436365_0258677_78_668 184
60 3300046616 Ga0495668_0031396 Ga0495668_0031396_545_1135 184
61 3300047472 Ga0495686_0003348 Ga0495686_0003348_3655_4257 184
62 3300048922 Ga0496119_0192860 Ga0496119_0192860_348_905 184
63 3300048923 Ga0496120_0008579 Ga0496120_0008579_1048_1605 184
64 3300049586 Ga0501070_0588955 Ga0501070_0588955_117_683 184
65 3300049590 Ga0501074_0231300 Ga0501074_0231300_246_812 184
66 3300049822 Ga0501035_0091425 Ga0501035_0091425_584_1150 184
67 3300050508 nmdc:mga09592_84564_c1 nmdc:mga09592_84564_c1_1113_1679 184
68 3300050509 nmdc:mga0qj67_35610_c1 nmdc:mga0qj67_35610_c1_2828_3394 184
69 3300050510 nmdc:mga06r32_23900_c1 nmdc:mga06r32_23900_c1_4667_5233 184
70 3300053119 Ga0500595_006707 Ga0500595_006707_2619_3209 184
71 3300053134 Ga0500658_0121484 Ga0500658_0121484_447_1010 184
72 3300053157 Ga0500624_009192 Ga0500624_009192_609_1241 184
73 3300053730 Ga0500645_003415 Ga0500645_003415_2175_2765 184
74 3300048929 Ga0496126_0069901 Ga0496126_0069901_540_1103 185
75 3300009148 Ga0105243_10762966 Ga0105243_107629661 187
76 3300035691 Ga0373931_0466529 Ga0373931_0466529_33_611 187
77 3300053158 Ga0500627_0068225 Ga0500627_0068225_849_1490 187
78 3300049582 Ga0501048_0106148 Ga0501048_0106148_479_1081 188
79 3300005327 Ga0070658_10277625 Ga0070658_102776252 189
80 3300005518 Ga0070699_100038838 Ga0070699_1000388382 189
81 3300005546 Ga0070696_100001478 Ga0070696_10000147817 189
82 3300005547 Ga0070693_100549773 Ga0070693_1005497731 189
83 3300009174 Ga0105241_10440007 Ga0105241_104400071 189
84 iso_pu_bacteria 2593339238 2595447690 190
85 iso_pu_bacteria 2593339239 2595450384 190
86 iso_pu_bacteria 2718218334 2721029126 190
87 iso_pu_bacteria 2734482264 2735835294 190
88 iso_pu_bacteria 2738543009 2739229591 190
89 iso_pu_bacteria 2842918807 2842922450 190
90 iso_pu_bacteria 2884338543 2884342315 190
91 iso_pu_bacteria 2919085039 2919087978 190
92 iso_pu_bacteria 2941471342 2941474777 190
93 iso_pu_bacteria 2953994433 2953996911 190
94 3300003323 rootH1_10012010 rootH1_100120103 191
95 3300050508 nmdc:mga09592_587981_c1 nmdc:mga09592_587981_c1_250_900 191
96 3300003792 Ga0055540_1017511 Ga0055540_10175112 193
97 3300009147 Ga0114129_10175924 Ga0114129_101759241 193
98 3300025303 Ga0209051_1003227 Ga0209051_10032274 193
99 3300025304 Ga0209257_1018933 Ga0209257_10189333 193
100 3300046519 Ga0495632_0000005 Ga0495632_0000005_261096_261683 193
101 3300002075 JGI24738J21930_10004646 JGI24738J21930_100046462 194
102 3300002737 JGI25162J39368_1012811 JGI25162J39368_10128111 194
103 3300003578 Ga0006562J51391_1043309 Ga0006562J51391_10433093 194
104 3300003792 Ga0055540_1037342 Ga0055540_10373422 194
105 3300004625 Ga0055543_1006987 Ga0055543_10069873 194
106 3300005262 Ga0065165_1000949 Ga0065165_100094912 194
107 3300005344 Ga0070661_100141887 Ga0070661_1001418872 194
108 3300013104 Ga0157370_10000076 Ga0157370_1000007662 194
109 3300013104 Ga0157370_10015413 Ga0157370_100154139 194
110 3300013105 Ga0157369_10048446 Ga0157369_100484461 194
111 3300014497 Ga0182008_10007487 Ga0182008_100074873 194
112 3300014497 Ga0182008_10026225 Ga0182008_100262253 194
113 3300015261 Ga0182006_1000082 Ga0182006_100008292 194
114 3300015261 Ga0182006_1000161 Ga0182006_100016147 194
115 3300015262 Ga0182007_10025909 Ga0182007_100259091 194
116 3300015262 Ga0182007_10072893 Ga0182007_100728932 194
117 3300015265 Ga0182005_1000015 Ga0182005_100001583 194
118 3300015265 Ga0182005_1002385 Ga0182005_10023855 194
119 3300015265 Ga0182005_1009919 Ga0182005_10099193 194
120 3300015265 Ga0182005_1020018 Ga0182005_10200183 194
121 3300017792 Ga0163161_10004876 Ga0163161_100048765 194
122 3300017792 Ga0163161_10073005 Ga0163161_100730053 194
123 3300025226 Ga0209674_100488 Ga0209674_10048814 194
124 3300025233 Ga0209437_101084 Ga0209437_1010849 194
125 3300025254 Ga0209148_1001683 Ga0209148_10016838 194
126 3300025303 Ga0209051_1006648 Ga0209051_10066485 194
127 3300025900 Ga0207710_10008673 Ga0207710_100086736 194
128 3300025904 Ga0207647_10000005 Ga0207647_10000005142 194
129 3300025920 Ga0207649_10300266 Ga0207649_103002662 194
130 3300028380 Ga0268265_11497078 Ga0268265_114970781 194
131 3300031911 Ga0307412_10001003 Ga0307412_1000100313 194
132 3300041404 Ga0439436_0000023 Ga0439436_0000023_20387_20971 194
133 3300041456 Ga0451795_0310429 Ga0451795_0310429_344_928 194
134 3300042184 Ga0450908_000069 Ga0450908_000069_2685_3269 194
135 3300046452 Ga0495617_000040 Ga0495617_000040_54437_55021 194
136 3300046452 Ga0495617_000172 Ga0495617_000172_22795_23379 194
137 3300046457 Ga0495590_0006998 Ga0495590_0006998_1536_2120 194
138 3300046460 Ga0495638_0000251 Ga0495638_0000251_21673_22257 194
139 3300046460 Ga0495638_0143529 Ga0495638_0143529_313_897 194
140 3300046471 Ga0495650_0003035 Ga0495650_0003035_7274_7858 194
141 3300046471 Ga0495650_0012126 Ga0495650_0012126_1455_2039 194
142 3300046491 Ga0495584_0006411 Ga0495584_0006411_3384_3968 194
143 3300046492 Ga0495585_0000024 Ga0495585_0000024_54934_55518 194
144 3300046492 Ga0495585_0001053 Ga0495585_0001053_21217_21801 194
145 3300046501 Ga0495607_0000034 Ga0495607_0000034_64705_65289 194
146 3300046501 Ga0495607_0000220 Ga0495607_0000220_9153_9737 194
147 3300046501 Ga0495607_0003784 Ga0495607_0003784_6889_7473 194
148 3300046507 Ga0495606_0000572 Ga0495606_0000572_30945_31529 194
149 3300046507 Ga0495606_0001013 Ga0495606_0001013_31052_31636 194
150 3300046507 Ga0495606_0003142 Ga0495606_0003142_8331_8915 194
151 3300046512 Ga0495610_0001255 Ga0495610_0001255_6465_7049 194
152 3300046512 Ga0495610_0020582 Ga0495610_0020582_2140_2724 194
153 3300046513 Ga0495616_0000090 Ga0495616_0000090_26992_27576 194
154 3300046513 Ga0495616_0008073 Ga0495616_0008073_1546_2130 194
155 3300046515 Ga0495620_0000117 Ga0495620_0000117_38137_38721 194
156 3300046515 Ga0495620_0003663 Ga0495620_0003663_2118_2702 194
157 3300046518 Ga0495631_0000049 Ga0495631_0000049_21497_22081 194
158 3300046518 Ga0495631_0000130 Ga0495631_0000130_39759_40343 194
159 3300046519 Ga0495632_0003909 Ga0495632_0003909_8829_9413 194
160 3300046519 Ga0495632_0025968 Ga0495632_0025968_147_731 194
161 3300046519 Ga0495632_0041002 Ga0495632_0041002_370_954 194
162 3300046520 Ga0495637_0005604 Ga0495637_0005604_3362_3946 194
163 3300046522 Ga0495643_0135264 Ga0495643_0135264_224_808 194
164 3300046524 Ga0495648_0000449 Ga0495648_0000449_41010_41594 194
165 3300046524 Ga0495648_0004692 Ga0495648_0004692_2834_3418 194
166 3300046538 Ga0495609_0003722 Ga0495609_0003722_5721_6305 194
167 3300046616 Ga0495668_0008983 Ga0495668_0008983_3545_4129 194
168 3300046648 Ga0495611_0000005 Ga0495611_0000005_189179_189763 194
169 3300046648 Ga0495611_0000054 Ga0495611_0000054_30494_31078 194
170 3300046660 Ga0495625_0000066 Ga0495625_0000066_60740_61324 194
171 3300046660 Ga0495625_0033385 Ga0495625_0033385_842_1426 194
172 3300046660 Ga0495625_0057361 Ga0495625_0057361_1434_2018 194
173 3300046665 Ga0495661_0000383 Ga0495661_0000383_30167_30751 194
174 3300046665 Ga0495661_0045421 Ga0495661_0045421_1908_2492 194
175 3300046691 Ga0495670_0002940 Ga0495670_0002940_6680_7264 194
176 3300046691 Ga0495670_0003944 Ga0495670_0003944_3667_4251 194
177 3300046691 Ga0495670_0029952 Ga0495670_0029952_1669_2253 194
178 3300046692 Ga0495671_0002031 Ga0495671_0002031_5581_6165 194
179 3300046694 Ga0495649_0010627 Ga0495649_0010627_3995_4579 194
180 3300046794 Ga0495589_0000026 Ga0495589_0000026_145198_145782 194
181 3300046810 Ga0495660_0000099 Ga0495660_0000099_32073_32657 194
182 3300046810 Ga0495660_0000277 Ga0495660_0000277_26876_27460 194
183 3300047323 Ga0495683_0000385 Ga0495683_0000385_713_1297 194
184 3300047446 Ga0495679_000010 Ga0495679_000010_60721_61305 194
185 3300047469 Ga0495673_0000038 Ga0495673_0000038_105848_106432 194
186 3300047469 Ga0495673_0000045 Ga0495673_0000045_64766_65350 194
187 3300047469 Ga0495673_0000212 Ga0495673_0000212_25329_25913 194
188 3300047472 Ga0495686_0000050 Ga0495686_0000050_99576_100160 194
189 3300047472 Ga0495686_0000320 Ga0495686_0000320_50796_51380 194
190 3300047472 Ga0495686_0002503 Ga0495686_0002503_16387_16971 194
191 3300047472 Ga0495686_0034268 Ga0495686_0034268_496_1080 194
192 3300047472 Ga0495686_0086091 Ga0495686_0086091_172_756 194
193 3300048903 Ga0496100_0007558 Ga0496100_0007558_2355_2939 194
194 3300048904 Ga0496101_0016569 Ga0496101_0016569_406_990 194
195 3300048909 Ga0496106_0008563 Ga0496106_0008563_2568_3152 194
196 3300048909 Ga0496106_0114871 Ga0496106_0114871_1106_1690 194
197 3300048911 Ga0496108_0795666 Ga0496108_0795666_143_727 194
198 3300048920 Ga0496117_0022088 Ga0496117_0022088_3414_3998 194
199 3300048920 Ga0496117_0210954 Ga0496117_0210954_471_1055 194
200 3300048921 Ga0496118_0000815 Ga0496118_0000815_23445_24029 194
201 3300048921 Ga0496118_0002713 Ga0496118_0002713_18096_18680 194
202 3300048921 Ga0496118_0164022 Ga0496118_0164022_434_1018 194
203 3300048923 Ga0496120_0106689 Ga0496120_0106689_487_1071 194
204 3300048924 Ga0496121_0001099 Ga0496121_0001099_37267_37851 194
205 3300048924 Ga0496121_0001168 Ga0496121_0001168_24905_25489 194
206 3300048924 Ga0496121_0001773 Ga0496121_0001773_20676_21260 194
207 3300048924 Ga0496121_0121444 Ga0496121_0121444_197_781 194
208 3300048925 Ga0496122_0022731 Ga0496122_0022731_1744_2328 194
209 3300048925 Ga0496122_0206107 Ga0496122_0206107_164_748 194
210 3300048926 Ga0496123_0013555 Ga0496123_0013555_1866_2450 194
211 3300048927 Ga0496124_0000760 Ga0496124_0000760_45204_45794 194
212 3300048928 Ga0496125_0023955 Ga0496125_0023955_3866_4450 194
213 3300048929 Ga0496126_0013640 Ga0496126_0013640_6442_7026 194
214 3300049459 Ga0495678_000235 Ga0495678_000235_24741_25325 194
215 3300049460 Ga0495682_0002327 Ga0495682_0002327_5605_6189 194
216 3300053087 Ga0500643_000126 Ga0500643_000126_13724_14308 194
217 3300053103 Ga0500555_000469 Ga0500555_000469_2442_3026 194
218 3300053160 Ga0500633_0002709 Ga0500633_0002709_1882_2466 194
219 3300053730 Ga0500645_001047 Ga0500645_001047_12730_13314 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

27

199

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.971 6 180
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9481 7 186
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9463 7 182
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9452 5 182
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9294 6 180
ID Description Score Start End Superfamily
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9725 5 179 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9542 7 182 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9467 5 182 1.10.340.30
af_O05311_6_193_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9298 5 180 1.10.340.30
1p7mA00 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9223 5 174 1.10.340.30
ID Description Score Start End GO Terms
AF-G6EHB2-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9954 17 182 GO:0006284
GO:0008725
GO:0046872
AF-A0A0N0XKE9-F1-model_v4 DNA-3-methyladenine glycosylase 1 (EC 3.2.2.20) 0.9917 4 182 GO:0006284
GO:0008725
GO:0046872
AF-A0A0Q4HN91-F1-model_v4 deleted 0.9898 18 184
AF-A0A2W4I4B0-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9883 18 181 GO:0006284
GO:0008725
GO:0046872
AF-A0A7H0LMW5-F1-model_v4 DNA-3-methyladenine glycosylase I 0.988 5 182 GO:0006284
GO:0008725
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.18 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map