F330530

General Info

Members Datasets Scaffolds Average Seq Length
218 166 436 246

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2784746763|2785344605
Length 285
Sequence GVGFQYLVQGQKWVARHGKQYGFGLIPGLITLVLYLAALTALAVWGPDFVAWCTPFADDWSSPWSGLFRGLLTAVLFALALLLSVVTFTAMTLLIGQPFYENLSEKVDQDVSPDGTAPESGLPFWRELWISARDSLRIVARAALWGVLLFGLGFVPFVGQTVVPVIGFFVTGFFLTEELTGVALQRRRIELRDRLRLLRSRRMLVWGFGTPLGLAFLVPFVAVFLMPGAVAGATLMVRDLLGEETTGGDDRDDHDDHDGRSGGGPGGGHAPRPRPADPWTKPQVR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
10 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
16 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
17 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
21 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
22 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
23 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
24 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
25 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
26 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
27 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
28 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
29 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
30 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
31 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
32 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
33 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
34 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
35 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
36 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
37 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
38 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
39 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
40 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
41 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
42 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
43 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
44 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
49 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
50 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
57 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
61 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
62 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
63 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
64 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
65 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
68 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
72 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
79 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
80 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
89 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
90 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
115 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
117 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
118 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
119 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
120 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
121 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
122 2643221647 Streptomyces sp. Root369 Isolate Unclassified
123 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
124 2643221714 Streptomyces sp. Root264 Isolate Unclassified
125 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
126 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
127 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
128 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
129 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
130 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
131 2808606448 Streptomyces sp. 193411 Isolate Unclassified
132 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
133 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
134 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
135 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
136 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
137 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
138 2862574272 Streptomyces sp. AcE210 Isolate Nodule
139 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
140 2867428634 Streptomyces sp. RP5T Isolate Unclassified
141 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
142 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
143 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
144 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
145 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
146 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
147 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
148 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
149 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
150 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
151 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
152 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
153 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
154 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
155 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
156 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
157 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
158 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
159 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
160 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
161 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
162 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
163 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
164 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
165 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
166 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.15
Metatranscriptomes 0.92
Isolates 22.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 1.83
Rhizoplane 0
Rhizosphere 76.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10020682 3300001989 Bacteria 2350
2 JGI24738J21930_10007102 3300002075 Bacteria 2600
3 rootH1_10015258 3300003316 Bacteria 10891
4 rootH1_10027765 3300003316 Bacteria 1622
5 rootH1_10033010 3300003323 Bacteria 7649
6 rootH1_10052610 3300003323 Bacteria 2235
7 Ga0006562J51391_1118234 3300003578 Bacteria 4160
8 Ga0006562J51391_1118237 3300003578 Bacteria 1350
9 Ga0070661_100643246 3300005344 Bacteria 860
10 Ga0068855_100404276 3300005563 Bacteria 1496
11 Ga0075363_100014082 3300006048 Bacteria 3896
12 Ga0070715_10095593 3300006163 Bacteria 1376
13 Ga0099826_10137811 3300006948 Bacteria 1414
14 Ga0105244_10125427 3300009036 Bacteria 1241
15 Ga0105245_10081555 3300009098 Bacteria 2958
16 Ga0105243_10054160 3300009148 Bacteria 3184
17 Ga0105246_10004643 3300011119 Bacteria 8361
18 Ga0209758_1007449 3300025297 Bacteria 7443
19 Ga0207426_1002245 3300025302 Bacteria 12849
20 Ga0207647_10094008 3300025904 Bacteria 1786
21 Ga0207709_10068253 3300025935 Bacteria 2247
22 Ga0207702_10115637 3300026078 Bacteria 2393
23 Ga0307515_10000262 3300028794 Bacteria 130525
24 Ga0307511_10001166 3300030521 Bacteria 27969
25 Ga0307512_10008769 3300030522 Bacteria 9819
26 Ga0307512_10017371 3300030522 Bacteria 6605
27 Ga0307513_10040693 3300031456 Bacteria 5137
28 Ga0307509_10134449 3300031507 Bacteria 2421
29 Ga0307508_10070081 3300031616 Bacteria 3079
30 Ga0307516_10065636 3300031730 Bacteria 3504
31 Ga0307507_10006930 3300033179 Bacteria 16871
32 Ga0307507_10104973 3300033179 Bacteria 2341
33 Ga0307510_10049110 3300033180 Bacteria 4492
34 Ga0395898_0013495 3300037466 Bacteria 8412
35 Ga0395898_0345023 3300037466 Bacteria 1420
36 Ga0395901_0236254 3300038443 Bacteria 1907
37 Ga0439436_0006737 3300041404 Bacteria 3528
38 Ga0439439_0004903 3300041406 Bacteria 3035
39 Ga0451837_1035217 3300041494 Bacteria 1399
40 Ga0451853_0085053 3300041512 Bacteria 3454
41 Ga0451853_0989110 3300041512 Bacteria 6313
42 Ga0439433_0002526 3300041999 Bacteria 3884
43 Ga0439433_0002850 3300041999 Bacteria 3695
44 Ga0439449_0017436 3300042007 Bacteria 2696
45 Ga0439449_0079299 3300042007 Bacteria 1211
46 Ga0439455_0004164 3300042012 Bacteria 2844
47 Ga0439457_000467 3300042014 Bacteria 11671
48 Ga0439457_000686 3300042014 Bacteria 10018
49 Ga0439462_0018404 3300042015 Bacteria 1814
50 Ga0450903_000036 3300042138 Bacteria 26817
51 Ga0439458_0002533 3300042157 Bacteria 4426
52 Ga0466969_0018551 3300044656 Bacteria 3623
53 Ga0466972_0010400 3300044658 Bacteria 4672
54 Ga0466972_0021856 3300044658 Bacteria 3187
55 Ga0466972_0061963 3300044658 Bacteria 1793
56 Ga0466965_0000323 3300044683 Bacteria 16008
57 Ga0466966_0000906 3300044684 Bacteria 18841
58 Ga0466966_0002905 3300044684 Bacteria 11294
59 Ga0466961_0001413 3300044693 Bacteria 14886
60 Ga0466961_0006324 3300044693 Bacteria 7520
61 Ga0466963_0000356 3300044694 Bacteria 20688
62 Ga0466963_0000390 3300044694 Bacteria 20004
63 Ga0466963_0023809 3300044694 Bacteria 3893
64 Ga0466964_0035389 3300044706 Bacteria 1996
65 Ga0466964_0070017 3300044706 Bacteria 1481
66 Ga0466971_0001789 3300044719 Bacteria 9115
67 Ga0466968_0093439 3300044735 Bacteria 1336
68 Ga0466968_0126022 3300044735 Bacteria 1162
69 Ga0466970_0000859 3300044765 Bacteria 14640
70 Ga0466970_0012944 3300044765 Bacteria 4272
71 Ga0466957_0000583 3300044842 Bacteria 18472
72 Ga0466957_0067279 3300044842 Bacteria 2210
73 Ga0466959_0001064 3300045049 Bacteria 16430
74 Ga0466958_0004057 3300045836 Bacteria 7681
75 Ga0466958_0182743 3300045836 Bacteria 1331
76 Ga0466967_0022213 3300045976 Bacteria 5171
77 Ga0466967_0567763 3300045976 Bacteria 1118
78 Ga0495592_0012496 3300046454 Bacteria 6452
79 Ga0495603_0064709 3300046455 Bacteria 2156
80 Ga0495629_0001804 3300046459 Bacteria 16777
81 Ga0495629_0003007 3300046459 Bacteria 12828
82 Ga0495629_0008407 3300046459 Bacteria 7592
83 Ga0495629_0042481 3300046459 Bacteria 3194
84 Ga0495651_0147322 3300046462 Bacteria 1700
85 Ga0495582_0034074 3300046473 Bacteria 2799
86 Ga0495582_0035355 3300046473 Bacteria 2748
87 Ga0495639_0032497 3300046475 Bacteria 2327
88 Ga0495662_0001487 3300046476 Bacteria 11593
89 Ga0495662_0007500 3300046476 Bacteria 5389
90 Ga0495664_0007733 3300046477 Bacteria 5981
91 Ga0495608_0078694 3300046511 Bacteria 2144
92 Ga0495628_0048510 3300046516 Bacteria 3366
93 Ga0495630_0075048 3300046517 Bacteria 2548
94 Ga0495643_0013024 3300046522 Bacteria 4996
95 Ga0495642_0063585 3300046528 Bacteria 1534
96 Ga0495652_0012329 3300046529 Bacteria 7716
97 Ga0495640_0095275 3300046533 Bacteria 1959
98 Ga0495587_0043814 3300046536 Bacteria 2663
99 Ga0495597_0027249 3300046542 Bacteria 2621
100 Ga0495645_0015656 3300046543 Bacteria 5395
101 Ga0495634_0001072 3300046642 Bacteria 25558
102 Ga0495635_0067433 3300046663 Bacteria 2454
103 Ga0495588_0031691 3300046674 Bacteria 2662
104 Ga0495588_0051344 3300046674 Bacteria 2124
105 Ga0495657_0006771 3300046675 Bacteria 8934
106 Ga0495657_0008454 3300046675 Bacteria 7870
107 Ga0495646_0000938 3300046680 Bacteria 16593
108 Ga0495658_0082013 3300046683 Bacteria 1895
109 Ga0495671_0006236 3300046692 Bacteria 6910
110 Ga0495649_0008065 3300046694 Bacteria 6360
111 Ga0495589_0009904 3300046794 Bacteria 4951
112 Ga0495600_0006520 3300046809 Bacteria 7103
113 Ga0495581_0021197 3300047315 Bacteria 3769
114 Ga0495604_0000177 3300047317 Bacteria 56559
115 Ga0495636_0027511 3300047318 Bacteria 2316
116 Ga0495676_0005112 3300047321 Bacteria 12024
117 Ga0495676_0043504 3300047321 Bacteria 3673
118 Ga0495687_007828 3300047443 Bacteria 6221
119 Ga0495685_004666 3300047447 Bacteria 4445
120 Ga0495685_006173 3300047447 Bacteria 3917
121 Ga0495681_0000764 3300047470 Bacteria 24797
122 Ga0495686_0039047 3300047472 Bacteria 3034
123 Ga0495593_0008499 3300047673 Bacteria 5968
124 Ga0495593_0091736 3300047673 Bacteria 1564
125 Ga0495614_0019897 3300048089 Bacteria 2903
126 Ga0501031_0003645 3300049568 Bacteria 9912
127 Ga0501031_0133801 3300049568 Bacteria 1620
128 Ga0501032_0010218 3300049569 Bacteria 6775
129 Ga0501033_0008064 3300049570 Bacteria 8156
130 Ga0501033_0046615 3300049570 Bacteria 3222
131 Ga0501033_0240159 3300049570 Bacteria 1285
132 Ga0501034_0005437 3300049571 Bacteria 13921
133 Ga0501034_0035145 3300049571 Bacteria 5082
134 Ga0501034_0473439 3300049571 Bacteria 1168
135 Ga0501036_0000116 3300049572 Bacteria 49710
136 Ga0501036_0028775 3300049572 Bacteria 4696
137 Ga0501037_0017754 3300049573 Bacteria 5236
138 Ga0501037_0212803 3300049573 Bacteria 1362
139 Ga0501037_0350698 3300049573 Bacteria 1018
140 Ga0501038_0007090 3300049574 Bacteria 10349
141 Ga0501038_0032149 3300049574 Bacteria 4631
142 Ga0501038_0086828 3300049574 Bacteria 2628
143 Ga0501038_0104937 3300049574 Bacteria 2348
144 Ga0501039_0223672 3300049575 Bacteria 1479
145 Ga0501039_0410616 3300049575 Bacteria 1063
146 Ga0501042_0055754 3300049578 Bacteria 2820
147 Ga0501043_0003901 3300049579 Bacteria 12244
148 Ga0501046_0042167 3300049580 Bacteria 3638
149 Ga0501046_0201298 3300049580 Bacteria 1482
150 Ga0501047_0038128 3300049581 Bacteria 4648
151 Ga0501047_0148818 3300049581 Bacteria 2217
152 Ga0501048_0025698 3300049582 Bacteria 4290
153 Ga0501048_0184379 3300049582 Bacteria 1479
154 Ga0501070_0000283 3300049586 Bacteria 47512
155 Ga0501070_0098917 3300049586 Bacteria 2413
156 Ga0501073_0329644 3300049589 Bacteria 1054
157 Ga0501074_0007556 3300049590 Bacteria 7864
158 Ga0501035_0175846 3300049822 Bacteria 1846
159 Ga0501035_0401944 3300049822 Bacteria 1139
160 Ga0501044_0006702 3300049823 Bacteria 12702
161 Ga0501044_0012453 3300049823 Bacteria 9211
162 Ga0501044_0075131 3300049823 Bacteria 3431
163 nmdc:mga03n38_15543_c1 3300050490 Bacteria 2941
164 nmdc:mga06z11_282871_c1 3300050494 Bacteria 983
165 Ga0500644_0028984 3300053088 Bacteria 1736
166 Ga0500640_003371 3300053095 Bacteria 5564
167 Ga0466962_0001300 3300061719 Bacteria 11530
168 Ga0466962_0033594 3300061719 Bacteria 2455
169 2785344605 2784746763 Bacteria 9783172
170 2547407812 2547132111 Bacteria 8013147
171 2585308379 2582581313 Bacteria 10042643
172 2585313194 2582581314 Bacteria 11452267
173 2616694651 2616644814 Bacteria 11555299
174 2644268901 2643221647 Bacteria 10741251
175 2644436118 2643221678 Bacteria 9540101
176 2644632024 2643221714 Bacteria 9015452
177 2784587666 2784132148 Bacteria 8627943
178 2785368297 2784746768 Bacteria 10036182
179 2786669296 2786546132 Bacteria 10419719
180 2804844704 2802429296 Bacteria 7227771
181 2808840944 2808606359 Bacteria 9866990
182 2808919528 2808606375 Bacteria 9466072
183 2809231233 2808606448 Bacteria 8656184
184 2812359250 2811994879 Bacteria 9313447
185 2812481419 2811994917 Bacteria 7761064
186 2852640801 2852635781 Bacteria 8251373
187 2862288377 2862281513 Bacteria 9621493
188 2862389610 2862382967 Bacteria 10317375
189 2862513999 2862507626 Bacteria 9425308
190 2862582587 2862574272 Bacteria 10567477
191 2863405868 2863404153 Bacteria 9672205
192 2867432283 2867428634 Bacteria 9590268
193 2877682280 2877676314 Bacteria 9512378
194 2912721179 2912715099 Bacteria 9460473
195 2912725206 2912723979 Bacteria 8557534
196 2919468430 2919468124 Bacteria 9133025
197 2946066634 2946064051 Bacteria 8957905
198 2946074902 2946072368 Bacteria 8999607
199 2954003979 2954002825 Bacteria 9173742
200 2954387414 2954380949 Bacteria 10050426
201 2954675759 2954673503 Bacteria 9685905
202 2954688505 2954682443 Bacteria 9862841
203 2954698244 2954691527 Bacteria 10720516
204 2954703983 2954701450 Bacteria 10834262
205 2954717266 2954711539 Bacteria 10867210
206 2954727234 2954721474 Bacteria 10456478
207 2954734558 2954731030 Bacteria 10243860
208 2954746140 2954740390 Bacteria 10229294
209 2954753455 2954749733 Bacteria 10366972
210 2954765107 2954759201 Bacteria 9358192
211 2990067044 2990059506 Bacteria 9321252
212 3006397313 3006393351 Bacteria 6615579
213 3006501932 3006493962 Bacteria 8825450
214 8008559255 8008558824 Bacteria 10610750
215 8008579802 8008574985 Bacteria 7815457
216 8023630405 8023623736 Bacteria 8593882
217 8025416220 8025413630 Bacteria 7014048
218 8048407962 8048406513 Bacteria 8936924
219 JGI24739J22299_10020682
220 JGI24738J21930_10007102
221 rootH1_10015258
222 rootH1_10027765
223 rootH1_10033010
224 rootH1_10052610
225 Ga0006562J51391_1118234
226 Ga0006562J51391_1118237
227 Ga0070661_100643246
228 Ga0068855_100404276
229 Ga0075363_100014082
230 Ga0070715_10095593
231 Ga0099826_10137811
232 Ga0105244_10125427
233 Ga0105245_10081555
234 Ga0105243_10054160
235 Ga0105246_10004643
236 Ga0209758_1007449
237 Ga0207426_1002245
238 Ga0207647_10094008
239 Ga0207709_10068253
240 Ga0207702_10115637
241 Ga0307515_10000262
242 Ga0307511_10001166
243 Ga0307512_10008769
244 Ga0307512_10017371
245 Ga0307513_10040693
246 Ga0307509_10134449
247 Ga0307508_10070081
248 Ga0307516_10065636
249 Ga0307507_10006930
250 Ga0307507_10104973
251 Ga0307510_10049110
252 Ga0395898_0013495
253 Ga0395898_0345023
254 Ga0395901_0236254
255 Ga0439436_0006737
256 Ga0439439_0004903
257 Ga0451837_1035217
258 Ga0451853_0085053
259 Ga0451853_0989110
260 Ga0439433_0002526
261 Ga0439433_0002850
262 Ga0439449_0017436
263 Ga0439449_0079299
264 Ga0439455_0004164
265 Ga0439457_000467
266 Ga0439457_000686
267 Ga0439462_0018404
268 Ga0450903_000036
269 Ga0439458_0002533
270 Ga0466969_0018551
271 Ga0466972_0010400
272 Ga0466972_0021856
273 Ga0466972_0061963
274 Ga0466965_0000323
275 Ga0466966_0000906
276 Ga0466966_0002905
277 Ga0466961_0001413
278 Ga0466961_0006324
279 Ga0466963_0000356
280 Ga0466963_0000390
281 Ga0466963_0023809
282 Ga0466964_0035389
283 Ga0466964_0070017
284 Ga0466971_0001789
285 Ga0466968_0093439
286 Ga0466968_0126022
287 Ga0466970_0000859
288 Ga0466970_0012944
289 Ga0466957_0000583
290 Ga0466957_0067279
291 Ga0466959_0001064
292 Ga0466958_0004057
293 Ga0466958_0182743
294 Ga0466967_0022213
295 Ga0466967_0567763
296 Ga0495592_0012496
297 Ga0495603_0064709
298 Ga0495629_0001804
299 Ga0495629_0003007
300 Ga0495629_0008407
301 Ga0495629_0042481
302 Ga0495651_0147322
303 Ga0495582_0034074
304 Ga0495582_0035355
305 Ga0495639_0032497
306 Ga0495662_0001487
307 Ga0495662_0007500
308 Ga0495664_0007733
309 Ga0495608_0078694
310 Ga0495628_0048510
311 Ga0495630_0075048
312 Ga0495643_0013024
313 Ga0495642_0063585
314 Ga0495652_0012329
315 Ga0495640_0095275
316 Ga0495587_0043814
317 Ga0495597_0027249
318 Ga0495645_0015656
319 Ga0495634_0001072
320 Ga0495635_0067433
321 Ga0495588_0031691
322 Ga0495588_0051344
323 Ga0495657_0006771
324 Ga0495657_0008454
325 Ga0495646_0000938
326 Ga0495658_0082013
327 Ga0495671_0006236
328 Ga0495649_0008065
329 Ga0495589_0009904
330 Ga0495600_0006520
331 Ga0495581_0021197
332 Ga0495604_0000177
333 Ga0495636_0027511
334 Ga0495676_0005112
335 Ga0495676_0043504
336 Ga0495687_007828
337 Ga0495685_004666
338 Ga0495685_006173
339 Ga0495681_0000764
340 Ga0495686_0039047
341 Ga0495593_0008499
342 Ga0495593_0091736
343 Ga0495614_0019897
344 Ga0501031_0003645
345 Ga0501031_0133801
346 Ga0501032_0010218
347 Ga0501033_0008064
348 Ga0501033_0046615
349 Ga0501033_0240159
350 Ga0501034_0005437
351 Ga0501034_0035145
352 Ga0501034_0473439
353 Ga0501036_0000116
354 Ga0501036_0028775
355 Ga0501037_0017754
356 Ga0501037_0212803
357 Ga0501037_0350698
358 Ga0501038_0007090
359 Ga0501038_0032149
360 Ga0501038_0086828
361 Ga0501038_0104937
362 Ga0501039_0223672
363 Ga0501039_0410616
364 Ga0501042_0055754
365 Ga0501043_0003901
366 Ga0501046_0042167
367 Ga0501046_0201298
368 Ga0501047_0038128
369 Ga0501047_0148818
370 Ga0501048_0025698
371 Ga0501048_0184379
372 Ga0501070_0000283
373 Ga0501070_0098917
374 Ga0501073_0329644
375 Ga0501074_0007556
376 Ga0501035_0175846
377 Ga0501035_0401944
378 Ga0501044_0006702
379 Ga0501044_0012453
380 Ga0501044_0075131
381 nmdc:mga03n38_15543_c1
382 nmdc:mga06z11_282871_c1
383 Ga0500644_0028984
384 Ga0500640_003371
385 Ga0466962_0001300
386 Ga0466962_0033594
387 2785344605
388 2547407812
389 2585308379
390 2585313194
391 2616694651
392 2644268901
393 2644436118
394 2644632024
395 2784587666
396 2785368297
397 2786669296
398 2804844704
399 2808840944
400 2808919528
401 2809231233
402 2812359250
403 2812481419
404 2852640801
405 2862288377
406 2862389610
407 2862513999
408 2862582587
409 2863405868
410 2867432283
411 2877682280
412 2912721179
413 2912725206
414 2919468430
415 2946066634
416 2946074902
417 2954003979
418 2954387414
419 2954675759
420 2954688505
421 2954698244
422 2954703983
423 2954717266
424 2954727234
425 2954734558
426 2954746140
427 2954753455
428 2954765107
429 2990067044
430 3006397313
431 3006501932
432 8008559255
433 8008579802
434 8023630405
435 8025416220
436 8048407962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07264

EI24

Sulfate transporter CysZ/Etoposide-induced protein 2.4

6

227

0.92

Map