F330377

General Info

Members Datasets Scaffolds Average Seq Length
218 141 436 275

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0678351|Ga0496104_0678351_45_851
Length 240
Sequence MTLPRFRPESDPGPNFLSLLRKLGQEPLLNNPSAAAPAPFEIRHGTTIAAIRYADGVVMIGDRRATAGSSIAHRAMDKVHPADRHSGVAIAGAAGPALEMVKLFQLQLEHYEKVEGQALSLEGKANQLAQMVRSNLPMAMQGFVVVPLFAGYDLRRRTGRIYTYDPTGGRYEETDFHAAVHALYEAADEDSATGGPDAVRGIYPTVATITAAGYESVPEEEVAAGFASIISRRAARGQQP

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
28 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
41 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
51 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
52 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
53 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
56 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
67 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
68 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
69 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
70 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
77 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
78 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
79 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
84 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
85 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.5
Nodule 0
Rhizoplane 3.67
Rhizosphere 86.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0678351 3300048907 Bacteria 939
2 JGI25407J50210_10000231 3300003373 Bacteria 9653
3 JGI25405J52794_10041142 3300003911 Bacteria 978
4 Ga0070700_100384170 3300005441 Bacteria 1051
5 Ga0070662_100479836 3300005457 Bacteria 1035
6 Ga0070707_100072128 3300005468 Bacteria 3327
7 Ga0070679_100783058 3300005530 Bacteria 897
8 Ga0070672_100400851 3300005543 Bacteria 1176
9 Ga0070686_100366310 3300005544 Bacteria 1087
10 Ga0081455_10017807 3300005937 Bacteria 6792
11 Ga0081455_10044633 3300005937 Bacteria 3864
12 Ga0081455_10242013 3300005937 Bacteria 1325
13 Ga0081538_10015711 3300005981 Bacteria 5845
14 Ga0075365_10128937 3300006038 Bacteria 1749
15 Ga0075365_10231377 3300006038 Bacteria 1297
16 Ga0075363_100004368 3300006048 Bacteria 6170
17 Ga0075367_10063305 3300006178 Bacteria 2211
18 Ga0075428_100001516 3300006844 Bacteria 24855
19 Ga0075428_100082882 3300006844 Bacteria 3499
20 Ga0075428_100089383 3300006844 Bacteria 3360
21 Ga0075428_100262444 3300006844 Bacteria 1859
22 Ga0075430_100026361 3300006846 Bacteria 4946
23 Ga0075430_100050149 3300006846 Bacteria 3521
24 Ga0075430_100138179 3300006846 Bacteria 2030
25 Ga0075430_100244230 3300006846 Bacteria 1488
26 Ga0075431_100050421 3300006847 Bacteria 4292
27 Ga0075431_100110081 3300006847 Bacteria 2843
28 Ga0075431_100176544 3300006847 Bacteria 2194
29 Ga0075431_100210084 3300006847 Bacteria 1988
30 Ga0075434_100242397 3300006871 Bacteria 1823
31 Ga0075429_100000303 3300006880 Bacteria 34915
32 Ga0075429_100197188 3300006880 Bacteria 1764
33 Ga0111539_10053495 3300009094 Bacteria 4805
34 Ga0111539_10064306 3300009094 Bacteria 4340
35 Ga0105245_10023654 3300009098 Bacteria 5393
36 Ga0105245_10295305 3300009098 Bacteria 1588
37 Ga0105245_10590289 3300009098 Bacteria 1136
38 Ga0114129_10000100 3300009147 Bacteria 84154
39 Ga0114129_10019673 3300009147 Bacteria 9610
40 Ga0114129_10532793 3300009147 Bacteria 1530
41 Ga0105242_10064818 3300009176 Bacteria 3012
42 Ga0105242_10451108 3300009176 Bacteria 1212
43 Ga0105249_10518679 3300009553 Bacteria 1239
44 Ga0157378_10134937 3300013297 Bacteria 2287
45 Ga0157380_10274646 3300014326 Bacteria 1538
46 Ga0213873_10008103 3300021358 Bacteria 2133
47 Ga0213876_10128940 3300021384 Bacteria 1344
48 Ga0207687_10001769 3300025927 Bacteria 14852
49 Ga0207687_10002347 3300025927 Bacteria 12871
50 Ga0207691_10066920 3300025940 Bacteria 3249
51 Ga0207712_10406238 3300025961 Bacteria 1146
52 Ga0207640_10382551 3300025981 Bacteria 1141
53 Ga0207703_10307877 3300026035 Bacteria 1447
54 Ga0207708_10274880 3300026075 Bacteria 1363
55 Ga0207428_10031703 3300027907 Bacteria 4357
56 Ga0265338_10002533 3300028800 Bacteria 27091
57 Ga0265325_10000711 3300031241 Bacteria 24083
58 Ga0265331_10041870 3300031250 Bacteria 2224
59 Ga0265327_10025113 3300031251 Bacteria 3482
60 Ga0265327_10106984 3300031251 Bacteria 1342
61 Ga0316579_10025238 3300031691 Bacteria 2682
62 Ga0265314_10147021 3300031711 Bacteria 1450
63 Ga0316576_10014401 3300031727 Bacteria 5284
64 Ga0316576_10046357 3300031727 Bacteria 3146
65 Ga0307405_10574792 3300031731 Bacteria 916
66 Ga0316577_10054196 3300031733 Bacteria 2238
67 Ga0307410_10025686 3300031852 Bacteria 3699
68 Ga0307407_10121908 3300031903 Bacteria 1654
69 Ga0307409_100001873 3300031995 Bacteria 10714
70 Ga0307409_100183470 3300031995 Bacteria 1855
71 Ga0307416_100062431 3300032002 Bacteria 3047
72 Ga0307415_100025455 3300032126 Bacteria 3714
73 Ga0307415_100175215 3300032126 Bacteria 1677
74 Ga0373930_0001644 3300034816 Bacteria 3374
75 Ga0373948_0000452 3300034817 Bacteria 5110
76 Ga0373957_0059670 3300035120 Bacteria 1476
77 Ga0373955_0130902 3300035172 Bacteria 1464
78 Ga0316574_0002995 3300035398 Bacteria 8611
79 Ga0316574_0077897 3300035398 Bacteria 2101
80 Ga0316574_0084947 3300035398 Bacteria 2014
81 Ga0316574_0298695 3300035398 Bacteria 1024
82 Ga0373931_0000051 3300035691 Bacteria 62223
83 Ga0373933_0182354 3300035724 Bacteria 1339
84 Ga0373937_0017613 3300036401 Bacteria 6370
85 Ga0316582_0004262 3300036647 Bacteria 7187
86 Ga0316584_0144233 3300036712 Bacteria 1774
87 Ga0316584_0293376 3300036712 Bacteria 1179
88 Ga0373925_0368955 3300037068 Bacteria 1168
89 Ga0436364_0132315 3300037853 Bacteria 1553
90 Ga0400483_153053 3300039062 Bacteria 1249
91 Ga0436365_0631611 3300039437 Bacteria 1070
92 Ga0436365_1068193 3300039437 Bacteria 2353
93 Ga0436365_1644834 3300039437 Bacteria 5054
94 Ga0436360_1114796 3300039438 Bacteria 3208
95 Ga0436361_0634789 3300039447 Bacteria 2035
96 Ga0436362_0913770 3300039453 Bacteria 2098
97 Ga0451797_0026065 3300041453 Bacteria 2645
98 Ga0451837_1130963 3300041494 Bacteria 1674
99 Ga0451837_1565804 3300041494 Bacteria 1233
100 Ga0451843_0915933 3300041509 Bacteria 1371
101 Ga0439434_0004095 3300042435 Bacteria 4257
102 Ga0466959_0039220 3300045049 Bacteria 3500
103 Ga0495629_0040270 3300046459 Bacteria 3287
104 Ga0495629_0205810 3300046459 Bacteria 1360
105 Ga0495651_0365765 3300046462 Bacteria 949
106 Ga0495653_0104452 3300046463 Bacteria 2047
107 Ga0495608_0020956 3300046511 Bacteria 4489
108 Ga0495608_0133818 3300046511 Bacteria 1585
109 Ga0495640_0112186 3300046533 Bacteria 1781
110 Ga0495586_0016685 3300046535 Bacteria 3906
111 Ga0495621_0003392 3300046539 Bacteria 4398
112 Ga0495667_0004078 3300046559 Bacteria 9812
113 Ga0495634_0127823 3300046642 Bacteria 1622
114 Ga0495635_0032755 3300046663 Bacteria 3605
115 Ga0495657_0001706 3300046675 Bacteria 18831
116 Ga0495599_0164574 3300046678 Bacteria 1370
117 Ga0495623_0009893 3300046679 Bacteria 6177
118 Ga0495646_0223615 3300046680 Bacteria 1017
119 Ga0495613_0019455 3300046689 Bacteria 5060
120 Ga0495613_0119882 3300046689 Bacteria 1890
121 Ga0495600_0018998 3300046809 Bacteria 4386
122 Ga0495604_0108283 3300047317 Bacteria 2030
123 Ga0495674_0342980 3300047319 Bacteria 1214
124 Ga0495680_0207635 3300047322 Bacteria 1403
125 Ga0495675_0049347 3300047444 Bacteria 2676
126 Ga0495593_0063417 3300047673 Bacteria 1930
127 Ga0495593_0181570 3300047673 Bacteria 1060
128 Ga0495602_0041848 3300048088 Bacteria 4180
129 Ga0495614_0039798 3300048089 Bacteria 2018
130 Ga0496104_0341236 3300048907 Bacteria 1411
131 Ga0496108_0029459 3300048911 Bacteria 4546
132 Ga0496109_0032561 3300048912 Bacteria 4686
133 Ga0496109_0119825 3300048912 Bacteria 2451
134 Ga0496111_0036484 3300048914 Bacteria 3515
135 Ga0496114_0067441 3300048917 Bacteria 3002
136 Ga0501031_0018639 3300049568 Bacteria 4520
137 Ga0501031_0237260 3300049568 Bacteria 1186
138 Ga0501033_0033055 3300049570 Bacteria 3884
139 Ga0501034_0000312 3300049571 Bacteria 86122
140 Ga0501034_0042122 3300049571 Bacteria 4622
141 Ga0501036_0213528 3300049572 Bacteria 1621
142 Ga0501037_0134429 3300049573 Bacteria 1772
143 Ga0501037_0236919 3300049573 Bacteria 1280
144 Ga0501039_0003383 3300049575 Bacteria 11926
145 Ga0501040_0004317 3300049576 Bacteria 9237
146 Ga0501041_0092017 3300049577 Bacteria 1872
147 Ga0501042_0011551 3300049578 Bacteria 5961
148 Ga0501042_0140562 3300049578 Bacteria 1741
149 Ga0501046_0013369 3300049580 Bacteria 6952
150 Ga0501048_0015362 3300049582 Bacteria 5654
151 Ga0501068_0000667 3300049584 Bacteria 17638
152 Ga0501068_0079056 3300049584 Bacteria 2016
153 Ga0501068_0140163 3300049584 Bacteria 1516
154 Ga0501069_0000052 3300049585 Bacteria 69909
155 Ga0501069_0042534 3300049585 Bacteria 2513
156 Ga0501070_0000030 3300049586 Bacteria 139270
157 Ga0501070_0004183 3300049586 Bacteria 12424
158 Ga0501070_0032971 3300049586 Bacteria 4332
159 Ga0501071_0045762 3300049587 Bacteria 3142
160 Ga0501071_0047700 3300049587 Bacteria 3077
161 Ga0501071_0096437 3300049587 Bacteria 2177
162 Ga0501072_0001216 3300049588 Bacteria 19224
163 Ga0501072_0044341 3300049588 Bacteria 3497
164 Ga0501072_0163505 3300049588 Bacteria 1776
165 Ga0501073_0002645 3300049589 Bacteria 13421
166 Ga0501073_0012657 3300049589 Bacteria 6153
167 Ga0501074_0002153 3300049590 Bacteria 13628
168 Ga0501074_0027276 3300049590 Bacteria 4141
169 Ga0501074_0212188 3300049590 Bacteria 1379
170 Ga0501075_0003039 3300049591 Bacteria 11207
171 Ga0501076_0004685 3300049592 Bacteria 9749
172 Ga0501076_0074802 3300049592 Bacteria 2714
173 Ga0501079_0007203 3300049741 Bacteria 8398
174 Ga0501079_0185017 3300049741 Bacteria 1626
175 Ga0501080_0004116 3300049742 Bacteria 12889
176 Ga0501080_0018599 3300049742 Bacteria 6430
177 Ga0501080_0031880 3300049742 Bacteria 4912
178 Ga0501080_0087124 3300049742 Bacteria 2901
179 Ga0501081_0008844 3300049743 Bacteria 6546
180 Ga0501081_0108782 3300049743 Bacteria 1966
181 Ga0501045_0013114 3300049824 Bacteria 5846
182 Ga0501045_0361299 3300049824 Bacteria 1080
183 nmdc:mga03n38_213222_c1 3300050490 Bacteria 1004
184 nmdc:mga00v17_60143_c1 3300050491 Bacteria 1403
185 nmdc:mga0yw44_131740_c1 3300050492 Bacteria 1619
186 nmdc:mga0yw44_16126_c1 3300050492 Bacteria 4028
187 nmdc:mga0yw44_224092_c1 3300050492 Bacteria 1247
188 nmdc:mga06z11_229130_c1 3300050494 Bacteria 1088
189 nmdc:mga05p37_285480_c1 3300050507 Bacteria 1967
190 nmdc:mga05p37_804_c2 3300050507 Bacteria 30686
191 nmdc:mga05p37_86064_c1 3300050507 Bacteria 3874
192 nmdc:mga09592_1658_c1 3300050508 Bacteria 17921
193 nmdc:mga09592_22018_c1 3300050508 Bacteria 5258
194 nmdc:mga09592_73020_c1 3300050508 Bacteria 2915
195 nmdc:mga0qj67_152629_c1 3300050509 Bacteria 1874
196 nmdc:mga0qj67_239503_c1 3300050509 Bacteria 1472
197 nmdc:mga0qj67_77573_c1 3300050509 Bacteria 2658
198 nmdc:mga06r32_187652_c1 3300050510 Bacteria 2055
199 nmdc:mga06r32_246242_c1 3300050510 Bacteria 1775
200 nmdc:mga06r32_316677_c1 3300050510 Bacteria 1546
201 nmdc:mga06r32_46885_c1 3300050510 Bacteria 4125
202 nmdc:mga06r32_50786_c1 3300050510 Bacteria 3967
203 nmdc:mga08y16_25989_c1 3300050511 Bacteria 6177
204 nmdc:mga08y16_34959_c1 3300050511 Bacteria 5280
205 nmdc:mga08y16_645118_c1 3300050511 Bacteria 1063
206 nmdc:mga0n895_294975_c1 3300050512 Bacteria 1644
207 nmdc:mga0rr50_286609_c1 3300050513 Bacteria 1375
208 nmdc:mga0a205_380198_c1 3300050515 Bacteria 1277
209 Ga0495601_0060935 3300053077 Bacteria 2395
210 Ga0500635_0004063 3300053080 Bacteria 3739
211 Ga0495595_0020609 3300053084 Bacteria 2871
212 Ga0495595_0147903 3300053084 Bacteria 1155
213 Ga0495619_0088840 3300053085 Bacteria 2090
214 Ga0495619_0108117 3300053085 Bacteria 1898
215 Ga0500566_0000568 3300053094 Bacteria 20773
216 Ga0501084_0000314 3300054114 Bacteria 36782
217 Ga0501084_0018407 3300054114 Bacteria 5816
218 Ga0501082_0050055 3300060353 Bacteria 3603
219 Ga0496104_0678351
220 JGI25407J50210_10000231
221 JGI25405J52794_10041142
222 Ga0070700_100384170
223 Ga0070662_100479836
224 Ga0070707_100072128
225 Ga0070679_100783058
226 Ga0070672_100400851
227 Ga0070686_100366310
228 Ga0081455_10017807
229 Ga0081455_10044633
230 Ga0081455_10242013
231 Ga0081538_10015711
232 Ga0075365_10128937
233 Ga0075365_10231377
234 Ga0075363_100004368
235 Ga0075367_10063305
236 Ga0075428_100001516
237 Ga0075428_100082882
238 Ga0075428_100089383
239 Ga0075428_100262444
240 Ga0075430_100026361
241 Ga0075430_100050149
242 Ga0075430_100138179
243 Ga0075430_100244230
244 Ga0075431_100050421
245 Ga0075431_100110081
246 Ga0075431_100176544
247 Ga0075431_100210084
248 Ga0075434_100242397
249 Ga0075429_100000303
250 Ga0075429_100197188
251 Ga0111539_10053495
252 Ga0111539_10064306
253 Ga0105245_10023654
254 Ga0105245_10295305
255 Ga0105245_10590289
256 Ga0114129_10000100
257 Ga0114129_10019673
258 Ga0114129_10532793
259 Ga0105242_10064818
260 Ga0105242_10451108
261 Ga0105249_10518679
262 Ga0157378_10134937
263 Ga0157380_10274646
264 Ga0213873_10008103
265 Ga0213876_10128940
266 Ga0207687_10001769
267 Ga0207687_10002347
268 Ga0207691_10066920
269 Ga0207712_10406238
270 Ga0207640_10382551
271 Ga0207703_10307877
272 Ga0207708_10274880
273 Ga0207428_10031703
274 Ga0265338_10002533
275 Ga0265325_10000711
276 Ga0265331_10041870
277 Ga0265327_10025113
278 Ga0265327_10106984
279 Ga0316579_10025238
280 Ga0265314_10147021
281 Ga0316576_10014401
282 Ga0316576_10046357
283 Ga0307405_10574792
284 Ga0316577_10054196
285 Ga0307410_10025686
286 Ga0307407_10121908
287 Ga0307409_100001873
288 Ga0307409_100183470
289 Ga0307416_100062431
290 Ga0307415_100025455
291 Ga0307415_100175215
292 Ga0373930_0001644
293 Ga0373948_0000452
294 Ga0373957_0059670
295 Ga0373955_0130902
296 Ga0316574_0002995
297 Ga0316574_0077897
298 Ga0316574_0084947
299 Ga0316574_0298695
300 Ga0373931_0000051
301 Ga0373933_0182354
302 Ga0373937_0017613
303 Ga0316582_0004262
304 Ga0316584_0144233
305 Ga0316584_0293376
306 Ga0373925_0368955
307 Ga0436364_0132315
308 Ga0400483_153053
309 Ga0436365_0631611
310 Ga0436365_1068193
311 Ga0436365_1644834
312 Ga0436360_1114796
313 Ga0436361_0634789
314 Ga0436362_0913770
315 Ga0451797_0026065
316 Ga0451837_1130963
317 Ga0451837_1565804
318 Ga0451843_0915933
319 Ga0439434_0004095
320 Ga0466959_0039220
321 Ga0495629_0040270
322 Ga0495629_0205810
323 Ga0495651_0365765
324 Ga0495653_0104452
325 Ga0495608_0020956
326 Ga0495608_0133818
327 Ga0495640_0112186
328 Ga0495586_0016685
329 Ga0495621_0003392
330 Ga0495667_0004078
331 Ga0495634_0127823
332 Ga0495635_0032755
333 Ga0495657_0001706
334 Ga0495599_0164574
335 Ga0495623_0009893
336 Ga0495646_0223615
337 Ga0495613_0019455
338 Ga0495613_0119882
339 Ga0495600_0018998
340 Ga0495604_0108283
341 Ga0495674_0342980
342 Ga0495680_0207635
343 Ga0495675_0049347
344 Ga0495593_0063417
345 Ga0495593_0181570
346 Ga0495602_0041848
347 Ga0495614_0039798
348 Ga0496104_0341236
349 Ga0496108_0029459
350 Ga0496109_0032561
351 Ga0496109_0119825
352 Ga0496111_0036484
353 Ga0496114_0067441
354 Ga0501031_0018639
355 Ga0501031_0237260
356 Ga0501033_0033055
357 Ga0501034_0000312
358 Ga0501034_0042122
359 Ga0501036_0213528
360 Ga0501037_0134429
361 Ga0501037_0236919
362 Ga0501039_0003383
363 Ga0501040_0004317
364 Ga0501041_0092017
365 Ga0501042_0011551
366 Ga0501042_0140562
367 Ga0501046_0013369
368 Ga0501048_0015362
369 Ga0501068_0000667
370 Ga0501068_0079056
371 Ga0501068_0140163
372 Ga0501069_0000052
373 Ga0501069_0042534
374 Ga0501070_0000030
375 Ga0501070_0004183
376 Ga0501070_0032971
377 Ga0501071_0045762
378 Ga0501071_0047700
379 Ga0501071_0096437
380 Ga0501072_0001216
381 Ga0501072_0044341
382 Ga0501072_0163505
383 Ga0501073_0002645
384 Ga0501073_0012657
385 Ga0501074_0002153
386 Ga0501074_0027276
387 Ga0501074_0212188
388 Ga0501075_0003039
389 Ga0501076_0004685
390 Ga0501076_0074802
391 Ga0501079_0007203
392 Ga0501079_0185017
393 Ga0501080_0004116
394 Ga0501080_0018599
395 Ga0501080_0031880
396 Ga0501080_0087124
397 Ga0501081_0008844
398 Ga0501081_0108782
399 Ga0501045_0013114
400 Ga0501045_0361299
401 nmdc:mga03n38_213222_c1
402 nmdc:mga00v17_60143_c1
403 nmdc:mga0yw44_131740_c1
404 nmdc:mga0yw44_16126_c1
405 nmdc:mga0yw44_224092_c1
406 nmdc:mga06z11_229130_c1
407 nmdc:mga05p37_285480_c1
408 nmdc:mga05p37_804_c2
409 nmdc:mga05p37_86064_c1
410 nmdc:mga09592_1658_c1
411 nmdc:mga09592_22018_c1
412 nmdc:mga09592_73020_c1
413 nmdc:mga0qj67_152629_c1
414 nmdc:mga0qj67_239503_c1
415 nmdc:mga0qj67_77573_c1
416 nmdc:mga06r32_187652_c1
417 nmdc:mga06r32_246242_c1
418 nmdc:mga06r32_316677_c1
419 nmdc:mga06r32_46885_c1
420 nmdc:mga06r32_50786_c1
421 nmdc:mga08y16_25989_c1
422 nmdc:mga08y16_34959_c1
423 nmdc:mga08y16_645118_c1
424 nmdc:mga0n895_294975_c1
425 nmdc:mga0rr50_286609_c1
426 nmdc:mga0a205_380198_c1
427 Ga0495601_0060935
428 Ga0500635_0004063
429 Ga0495595_0020609
430 Ga0495595_0147903
431 Ga0495619_0088840
432 Ga0495619_0108117
433 Ga0500566_0000568
434 Ga0501084_0000314
435 Ga0501084_0018407
436 Ga0501082_0050055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00227

Proteasome

Proteasome subunit

42

189

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q5q-assembly1.cif.gz_H the rhodococcus 20s proteasome 0.9272 46 259
7pxd-assembly1.cif.gz_Y substrate-engaged mycobacterial proteasome-associated atpase in complex with open-gate 20s cp - composite map (state b) 0.9211 46 260
5lzp-assembly1.cif.gz_G binding of the c-terminal gqyl motif of the bacterial proteasome activator bpa to the 20s proteasome 0.9202 46 260
5fmg-assembly1.cif.gz_W structure and function based design of plasmodium-selective proteasome inhibitors 0.9182 46 244
3h6i-assembly1.cif.gz_V crystal structure of mycobacterium tuberculosis proteasome modified by inhibitor gl1 0.9161 47 260
ID Description Score Start End Superfamily
af_Q966I8_19_219_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9187 41 244 3.60.20.10
5fmgW00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9182 46 244 3.60.20.10
1pma100 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9131 46 255 3.60.20.10
3h6fR00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9123 47 260 3.60.20.10
af_O62102_47_276_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9102 46 246 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A2W4MM98-F1-model_v4 Proteasome subunit beta (EC 3.4.25.1) 0.9519 41 257 GO:0004298
GO:0005737
GO:0005839
GO:0010498
AF-A0A7V8W5K8-F1-model_v4 Proteasome subunit beta (EC 3.4.25.1) 0.9474 94 257 GO:0004298
GO:0005839
GO:0010498
AF-A0A0A7LFY9-F1-model_v4 Proteasome subunit beta (EC 3.4.25.1) (20S proteasome beta subunit) (Proteasome core protein PsmB) 0.9376 44 255 GO:0004298
GO:0005737
GO:0010498
GO:0019774
AF-D1Z199-F1-model_v4 Proteasome subunit beta (EC 3.4.25.1) (20S proteasome beta subunit) (Proteasome core protein PsmB) 0.93 41 244 GO:0004298
GO:0005737
GO:0010498
GO:0019774
AF-A0A537YPI0-F1-model_v4 Proteasome subunit beta (EC 3.4.25.1) 0.929 3 257 GO:0004298
GO:0005737
GO:0005839
GO:0010498

Map