F330204

General Info

Members Datasets Scaffolds Average Seq Length
218 168 436 402

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0075886|Ga0395901_0075886_1818_3188
Length 456
Sequence MATFRNNSSAFKACELRHFRIVHKPRHRLSKEQYVPITDDAKDLQDDLARLRHDLHRQPEIGLHLPRTQEKVLQALDGLPYEITLGKDTTSVTAVLRGGRPAAGNGAGNHAAVNNSGKAAGERPVVLLRADMDGLPVQEKTGVDFTSRADGAMHACGHDLHTSMLAGAATLLAEKRHLLQGDVVLMFQPGEEGFDGASYMLREGVLDAAGPRVQAAYGMHVFSSLEPHGTFCTKSGVMLSASDGLEVTVLGAGGHGSAPHSAKDPVTVAAEMVTALQVMVTRQFNMFDPVVLSVGVLHAGTKRNVIPESARIEATIRTFSEASRLKMMDAVPRLLKGIAAAHGVEAAVDYLQEYPLTITSEDETHTAEKVITELFGERRLSRWATPLSGSEDFSRVLAEVPGTFVGLSAVAPGGDPATSPFNHSPYATFDDGVLADGAALYAELAMSRLATLSRAA

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
31 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
32 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
76 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
77 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
126 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
127 2643221561 Nocardioides sp. Root151 Isolate Unclassified
128 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
129 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
130 2643221696 Nocardioides sp. Root140 Isolate Unclassified
131 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
132 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
133 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
134 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
135 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
136 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
137 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
138 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
139 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
140 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
141 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
142 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
143 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
144 2867475112 Streptomyces sp. TM32 Isolate Unclassified
145 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
146 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
147 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
148 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
149 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
150 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
151 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
152 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
153 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
154 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
155 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
156 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
157 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
158 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
159 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
160 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
161 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
162 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
163 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
164 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
165 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
166 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
167 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
168 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.36
Metatranscriptomes 0
Isolates 20.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0.46
Rhizoplane 8.26
Rhizosphere 75.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0075886 3300038443 Bacteria 3507
2 JGI25152J39213_1000166 3300002773 Bacteria 45163
3 JGI25151J46595_10025256 3300003187 Bacteria 2420
4 rootH2_10073324 3300003320 Bacteria 2574
5 Ga0070658_10006452 3300005327 Bacteria 9507
6 Ga0070658_10278797 3300005327 Bacteria 1423
7 Ga0070683_100063463 3300005329 Bacteria 3436
8 Ga0070666_10095991 3300005335 Bacteria 2040
9 Ga0070680_100027047 3300005336 Bacteria 4593
10 Ga0070660_100016900 3300005339 Bacteria 5309
11 Ga0070660_100132846 3300005339 Bacteria 1993
12 Ga0070669_100019782 3300005353 Bacteria 4811
13 Ga0070675_100166908 3300005354 Bacteria 1896
14 Ga0070671_100008970 3300005355 Bacteria 8024
15 Ga0070659_100000218 3300005366 Bacteria 44263
16 Ga0070659_100014107 3300005366 Bacteria 5963
17 Ga0070678_100077463 3300005456 Bacteria 2508
18 Ga0070679_100006789 3300005530 Bacteria 10675
19 Ga0070684_100111707 3300005535 Bacteria 2451
20 Ga0068870_10072059 3300005840 Bacteria 1887
21 Ga0068863_100101063 3300005841 Bacteria 2741
22 Ga0081539_10005823 3300005985 Bacteria 12243
23 Ga0075432_10001802 3300006058 Bacteria 7060
24 Ga0105244_10015793 3300009036 Bacteria 4321
25 Ga0105245_10066146 3300009098 Bacteria 3271
26 Ga0105245_10240863 3300009098 Bacteria 1753
27 Ga0105243_10034782 3300009148 Bacteria 3904
28 Ga0105243_10045579 3300009148 Bacteria 3446
29 Ga0105248_10141074 3300009177 Bacteria 2718
30 Ga0105249_10131637 3300009553 Bacteria 2389
31 Ga0105246_10005129 3300011119 Bacteria 7962
32 Ga0157370_10015358 3300013104 Bacteria 7783
33 Ga0157369_10032003 3300013105 Bacteria 5786
34 Ga0157369_10043448 3300013105 Bacteria 4898
35 Ga0157369_10062299 3300013105 Bacteria 4020
36 Ga0157369_10093552 3300013105 Bacteria 3208
37 Ga0157369_10292951 3300013105 Bacteria 1694
38 Ga0163163_10205233 3300014325 Bacteria 2019
39 Ga0209129_1000100 3300025258 Bacteria 162353
40 Ga0209025_1002281 3300025294 Bacteria 20916
41 Ga0207697_10003204 3300025315 Bacteria 8142
42 Ga0207697_10014017 3300025315 Bacteria 3337
43 Ga0207655_1025426 3300025728 Bacteria 2874
44 Ga0207713_1017071 3300025735 Bacteria 3656
45 Ga0207645_10002211 3300025907 Bacteria 15523
46 Ga0207705_10008302 3300025909 Bacteria 7584
47 Ga0207705_10144928 3300025909 Bacteria 1776
48 Ga0207705_10227847 3300025909 Bacteria 1417
49 Ga0207707_10136460 3300025912 Bacteria 2145
50 Ga0207660_10068133 3300025917 Bacteria 2580
51 Ga0207657_10018526 3300025919 Bacteria 6641
52 Ga0207652_10016488 3300025921 Bacteria 6034
53 Ga0207652_10156218 3300025921 Bacteria 2044
54 Ga0207681_10086322 3300025923 Bacteria 2229
55 Ga0207650_10025092 3300025925 Bacteria 4244
56 Ga0207690_10000933 3300025932 Bacteria 18694
57 Ga0207690_10013309 3300025932 Bacteria 4942
58 Ga0207709_10103313 3300025935 Bacteria 1889
59 Ga0207691_10001874 3300025940 Bacteria 20562
60 Ga0207661_10020335 3300025944 Bacteria 4961
61 Ga0207683_10264932 3300026121 Bacteria 1569
62 Ga0207428_10040639 3300027907 Bacteria 3770
63 Ga0207428_10071499 3300027907 Bacteria 2725
64 Ga0268266_10138431 3300028379 Bacteria 2183
65 Ga0268264_10079455 3300028381 Bacteria 2798
66 Ga0307515_10086402 3300028794 Bacteria 3999
67 Ga0307512_10005354 3300030522 Bacteria 13424
68 Ga0307512_10007934 3300030522 Bacteria 10431
69 Ga0265340_10024268 3300031247 Bacteria 3081
70 Ga0307513_10001682 3300031456 Bacteria 31664
71 Ga0307513_10020411 3300031456 Bacteria 7860
72 Ga0307408_100014944 3300031548 Bacteria 5165
73 Ga0307408_100020011 3300031548 Bacteria 4511
74 Ga0307408_100098651 3300031548 Bacteria 2221
75 Ga0316576_10127280 3300031727 Bacteria 1915
76 Ga0316576_10131296 3300031727 Bacteria 1884
77 Ga0316578_10052106 3300031728 Bacteria 2397
78 Ga0307405_10005475 3300031731 Bacteria 6127
79 Ga0307405_10019916 3300031731 Bacteria 3738
80 Ga0307405_10021820 3300031731 Bacteria 3606
81 Ga0316577_10064876 3300031733 Bacteria 2038
82 Ga0307413_10051320 3300031824 Bacteria 2485
83 Ga0307518_10007372 3300031838 Bacteria 7870
84 Ga0307410_10007885 3300031852 Bacteria 5865
85 Ga0307410_10039487 3300031852 Bacteria 3099
86 Ga0307406_10067939 3300031901 Bacteria 2325
87 Ga0307407_10007295 3300031903 Bacteria 4996
88 Ga0307407_10024752 3300031903 Bacteria 3153
89 Ga0307407_10138612 3300031903 Bacteria 1566
90 Ga0307412_10002884 3300031911 Bacteria 9531
91 Ga0307412_10008586 3300031911 Bacteria 5838
92 Ga0307412_10033115 3300031911 Bacteria 3281
93 Ga0307412_10047281 3300031911 Bacteria 2825
94 Ga0307409_100001445 3300031995 Bacteria 11663
95 Ga0307409_100093905 3300031995 Bacteria 2466
96 Ga0307416_100001021 3300032002 Bacteria 14845
97 Ga0307416_100013467 3300032002 Bacteria 5560
98 Ga0307416_100026075 3300032002 Bacteria 4300
99 Ga0307416_100048843 3300032002 Bacteria 3360
100 Ga0316584_0035771 3300036712 Bacteria 3684
101 Ga0395899_0059306 3300037312 Bacteria 2821
102 Ga0395899_0061771 3300037312 Bacteria 2759
103 Ga0395900_0027264 3300037418 Bacteria 5849
104 Ga0395900_0294513 3300037418 Bacteria 1610
105 Ga0395898_0033466 3300037466 Bacteria 5129
106 Ga0395898_0170661 3300037466 Bacteria 2079
107 Ga0395901_0042304 3300038443 Bacteria 4723
108 Ga0436365_1235482 3300039437 Bacteria 54275
109 Ga0439439_0004597 3300041406 Bacteria 3122
110 Ga0439465_0012715 3300041413 Bacteria 2633
111 Ga0439433_0004366 3300041999 Bacteria 3049
112 Ga0439449_0011585 3300042007 Bacteria 3316
113 Ga0439457_002180 3300042014 Bacteria 5666
114 Ga0466969_0013755 3300044656 Bacteria 4261
115 Ga0466961_0012826 3300044693 Bacteria 5363
116 Ga0466961_0030675 3300044693 Bacteria 3455
117 Ga0466971_0006549 3300044719 Bacteria 5062
118 Ga0466967_0052138 3300045976 Bacteria 3589
119 Ga0495651_0001176 3300046462 Bacteria 20215
120 Ga0495653_0001425 3300046463 Bacteria 18635
121 Ga0495580_0005285 3300046472 Bacteria 10719
122 Ga0495582_0023437 3300046473 Bacteria 3376
123 Ga0495662_0016542 3300046476 Bacteria 3573
124 Ga0495664_0002949 3300046477 Bacteria 9190
125 Ga0495628_0004662 3300046516 Bacteria 12097
126 Ga0495630_0031798 3300046517 Bacteria 3931
127 Ga0495652_0003770 3300046529 Bacteria 14804
128 Ga0495665_0000271 3300046531 Bacteria 26315
129 Ga0495665_0003913 3300046531 Bacteria 8060
130 Ga0495586_0002923 3300046535 Bacteria 9216
131 Ga0495645_0000942 3300046543 Bacteria 19846
132 Ga0495645_0048736 3300046543 Bacteria 3085
133 Ga0495645_0053606 3300046543 Bacteria 2931
134 Ga0495667_0002261 3300046559 Bacteria 12887
135 Ga0495611_0006782 3300046648 Bacteria 4868
136 Ga0495588_0004995 3300046674 Bacteria 5891
137 Ga0495657_0080037 3300046675 Bacteria 2115
138 Ga0495670_0015090 3300046691 Bacteria 3800
139 Ga0495600_0005238 3300046809 Bacteria 7804
140 Ga0495581_0001344 3300047315 Bacteria 13588
141 Ga0495581_0055835 3300047315 Bacteria 2279
142 Ga0495604_0052994 3300047317 Bacteria 3139
143 Ga0495680_0014246 3300047322 Bacteria 6895
144 Ga0495675_0001725 3300047444 Bacteria 13068
145 Ga0495677_0015718 3300047445 Bacteria 2748
146 Ga0496101_0086945 3300048904 Bacteria 2319
147 Ga0496102_0060553 3300048905 Bacteria 3462
148 Ga0496102_0091721 3300048905 Bacteria 2812
149 Ga0496102_0112488 3300048905 Bacteria 2539
150 Ga0496102_0186397 3300048905 Bacteria 1955
151 Ga0496102_0312218 3300048905 Bacteria 1482
152 Ga0496103_0007841 3300048906 Bacteria 6345
153 Ga0496103_0026733 3300048906 Bacteria 3492
154 Ga0496104_0079300 3300048907 Bacteria 3130
155 Ga0496105_0071972 3300048908 Bacteria 2857
156 Ga0496106_0005306 3300048909 Bacteria 9546
157 Ga0496106_0147433 3300048909 Bacteria 1854
158 Ga0496107_0000449 3300048910 Bacteria 22428
159 Ga0496109_0253734 3300048912 Bacteria 1656
160 Ga0496112_0035426 3300048915 Bacteria 4862
161 Ga0496113_0170464 3300048916 Bacteria 1724
162 Ga0496114_0044543 3300048917 Bacteria 3682
163 Ga0496114_0099985 3300048917 Bacteria 2474
164 Ga0501032_0008374 3300049569 Bacteria 7540
165 Ga0501034_0000066 3300049571 Bacteria 184727
166 Ga0501036_0151349 3300049572 Bacteria 1957
167 Ga0501037_0006009 3300049573 Bacteria 8861
168 Ga0501038_0094013 3300049574 Bacteria 2507
169 Ga0501039_0054382 3300049575 Bacteria 3098
170 Ga0501043_0022080 3300049579 Bacteria 4994
171 Ga0495619_0012232 3300053085 Bacteria 5399
172 Ga0500616_0000217 3300053153 Bacteria 90189
173 Ga0466962_0003378 3300061719 Bacteria 7597
174 2586061882 2585427649 Bacteria 9053857
175 2643825606 2643221561 Bacteria 4984412
176 2643853513 2643221567 Bacteria 4163945
177 2644137474 2643221624 Bacteria 4384879
178 2644531603 2643221696 Bacteria 5431823
179 2775657563 2775506735 Bacteria 4556596
180 2808828688 2808606357 Bacteria 4466944
181 2808849955 2808606360 Bacteria 4404006
182 2808877488 2808606366 Bacteria 4415912
183 2808893008 2808606370 Bacteria 4942454
184 2808898967 2808606371 Bacteria 4251511
185 2810366125 2808606700 Bacteria 3482157
186 2812319594 2811994871 Bacteria 4497550
187 2819744146 2818991472 Bacteria 10089953
188 2844850281 2844849076 Bacteria 4091819
189 2857742943 2857740372 Bacteria 4782044
190 2862508351 2862507626 Bacteria 9425308
191 2866554649 2866552031 Bacteria 5824618
192 2867480074 2867475112 Bacteria 6909112
193 2904500900 2904497146 Bacteria 4731781
194 2904779144 2904776348 Bacteria 4658726
195 2910811902 2910809715 Bacteria 4982797
196 2917743555 2917736166 Bacteria 9690793
197 2919037269 2919034639 Bacteria 4763403
198 2919061427 2919059106 Bacteria 4991624
199 2919395098 2919391150 Bacteria 4884741
200 2919447289 2919446982 Bacteria 3994487
201 2919542857 2919538618 Bacteria 4677069
202 2932429927 2932426870 Bacteria 4547726
203 2933419364 2933418574 Bacteria 4476724
204 2939601994 2939598168 Bacteria 4687164
205 2939650761 2939647034 Bacteria 4681660
206 2939674759 2939674588 Bacteria 4844420
207 2939675787 2939674588 Bacteria 4844420
208 2945917337 2945916053 Bacteria 4555517
209 2945922487 2945920336 Bacteria 4501603
210 2945960945 2945956166 Bacteria 5110334
211 2946037051 2946037020 Bacteria 4900426
212 2946037231 2946037020 Bacteria 4900426
213 2953998478 2953998280 Bacteria 4812144
214 2974305331 2974302888 Bacteria 4369871
215 2997607569 2997600082 Bacteria 9896405
216 8004022069 8004021418 Bacteria 4313954
217 8004025792 8004025490 Bacteria 4327753
218 8055161708 8055157932 Bacteria 6429399
219 Ga0395901_0075886
220 JGI25152J39213_1000166
221 JGI25151J46595_10025256
222 rootH2_10073324
223 Ga0070658_10006452
224 Ga0070658_10278797
225 Ga0070683_100063463
226 Ga0070666_10095991
227 Ga0070680_100027047
228 Ga0070660_100016900
229 Ga0070660_100132846
230 Ga0070669_100019782
231 Ga0070675_100166908
232 Ga0070671_100008970
233 Ga0070659_100000218
234 Ga0070659_100014107
235 Ga0070678_100077463
236 Ga0070679_100006789
237 Ga0070684_100111707
238 Ga0068870_10072059
239 Ga0068863_100101063
240 Ga0081539_10005823
241 Ga0075432_10001802
242 Ga0105244_10015793
243 Ga0105245_10066146
244 Ga0105245_10240863
245 Ga0105243_10034782
246 Ga0105243_10045579
247 Ga0105248_10141074
248 Ga0105249_10131637
249 Ga0105246_10005129
250 Ga0157370_10015358
251 Ga0157369_10032003
252 Ga0157369_10043448
253 Ga0157369_10062299
254 Ga0157369_10093552
255 Ga0157369_10292951
256 Ga0163163_10205233
257 Ga0209129_1000100
258 Ga0209025_1002281
259 Ga0207697_10003204
260 Ga0207697_10014017
261 Ga0207655_1025426
262 Ga0207713_1017071
263 Ga0207645_10002211
264 Ga0207705_10008302
265 Ga0207705_10144928
266 Ga0207705_10227847
267 Ga0207707_10136460
268 Ga0207660_10068133
269 Ga0207657_10018526
270 Ga0207652_10016488
271 Ga0207652_10156218
272 Ga0207681_10086322
273 Ga0207650_10025092
274 Ga0207690_10000933
275 Ga0207690_10013309
276 Ga0207709_10103313
277 Ga0207691_10001874
278 Ga0207661_10020335
279 Ga0207683_10264932
280 Ga0207428_10040639
281 Ga0207428_10071499
282 Ga0268266_10138431
283 Ga0268264_10079455
284 Ga0307515_10086402
285 Ga0307512_10005354
286 Ga0307512_10007934
287 Ga0265340_10024268
288 Ga0307513_10001682
289 Ga0307513_10020411
290 Ga0307408_100014944
291 Ga0307408_100020011
292 Ga0307408_100098651
293 Ga0316576_10127280
294 Ga0316576_10131296
295 Ga0316578_10052106
296 Ga0307405_10005475
297 Ga0307405_10019916
298 Ga0307405_10021820
299 Ga0316577_10064876
300 Ga0307413_10051320
301 Ga0307518_10007372
302 Ga0307410_10007885
303 Ga0307410_10039487
304 Ga0307406_10067939
305 Ga0307407_10007295
306 Ga0307407_10024752
307 Ga0307407_10138612
308 Ga0307412_10002884
309 Ga0307412_10008586
310 Ga0307412_10033115
311 Ga0307412_10047281
312 Ga0307409_100001445
313 Ga0307409_100093905
314 Ga0307416_100001021
315 Ga0307416_100013467
316 Ga0307416_100026075
317 Ga0307416_100048843
318 Ga0316584_0035771
319 Ga0395899_0059306
320 Ga0395899_0061771
321 Ga0395900_0027264
322 Ga0395900_0294513
323 Ga0395898_0033466
324 Ga0395898_0170661
325 Ga0395901_0042304
326 Ga0436365_1235482
327 Ga0439439_0004597
328 Ga0439465_0012715
329 Ga0439433_0004366
330 Ga0439449_0011585
331 Ga0439457_002180
332 Ga0466969_0013755
333 Ga0466961_0012826
334 Ga0466961_0030675
335 Ga0466971_0006549
336 Ga0466967_0052138
337 Ga0495651_0001176
338 Ga0495653_0001425
339 Ga0495580_0005285
340 Ga0495582_0023437
341 Ga0495662_0016542
342 Ga0495664_0002949
343 Ga0495628_0004662
344 Ga0495630_0031798
345 Ga0495652_0003770
346 Ga0495665_0000271
347 Ga0495665_0003913
348 Ga0495586_0002923
349 Ga0495645_0000942
350 Ga0495645_0048736
351 Ga0495645_0053606
352 Ga0495667_0002261
353 Ga0495611_0006782
354 Ga0495588_0004995
355 Ga0495657_0080037
356 Ga0495670_0015090
357 Ga0495600_0005238
358 Ga0495581_0001344
359 Ga0495581_0055835
360 Ga0495604_0052994
361 Ga0495680_0014246
362 Ga0495675_0001725
363 Ga0495677_0015718
364 Ga0496101_0086945
365 Ga0496102_0060553
366 Ga0496102_0091721
367 Ga0496102_0112488
368 Ga0496102_0186397
369 Ga0496102_0312218
370 Ga0496103_0007841
371 Ga0496103_0026733
372 Ga0496104_0079300
373 Ga0496105_0071972
374 Ga0496106_0005306
375 Ga0496106_0147433
376 Ga0496107_0000449
377 Ga0496109_0253734
378 Ga0496112_0035426
379 Ga0496113_0170464
380 Ga0496114_0044543
381 Ga0496114_0099985
382 Ga0501032_0008374
383 Ga0501034_0000066
384 Ga0501036_0151349
385 Ga0501037_0006009
386 Ga0501038_0094013
387 Ga0501039_0054382
388 Ga0501043_0022080
389 Ga0495619_0012232
390 Ga0500616_0000217
391 Ga0466962_0003378
392 2586061882
393 2643825606
394 2643853513
395 2644137474
396 2644531603
397 2775657563
398 2808828688
399 2808849955
400 2808877488
401 2808893008
402 2808898967
403 2810366125
404 2812319594
405 2819744146
406 2844850281
407 2857742943
408 2862508351
409 2866554649
410 2867480074
411 2904500900
412 2904779144
413 2910811902
414 2917743555
415 2919037269
416 2919061427
417 2919395098
418 2919447289
419 2919542857
420 2932429927
421 2933419364
422 2939601994
423 2939650761
424 2939674759
425 2939675787
426 2945917337
427 2945922487
428 2945960945
429 2946037051
430 2946037231
431 2953998478
432 2974305331
433 2997607569
434 8004022069
435 8004025792
436 8055161708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

127

447

0.91

PF07687

M20_dimer

Peptidase dimerisation domain

238

343

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ewt-assembly1.cif.gz_B the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.937 4 396
4ewt-assembly1.cif.gz_B the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.9202 4 396
1ysj-assembly1.cif.gz_B crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.9163 8 400
1ysj-assembly1.cif.gz_A crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.9146 8 400
4ewt-assembly1.cif.gz_D the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.9127 3 395
ID Description Score Start End Superfamily
af_A0A0R0IPM0_41_149_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9635 192 299 3.30.70.360
4ewtD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9547 191 304 3.30.70.360
af_A0A0R0IPM0_41_149_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9465 192 299 3.30.70.360
4ewtB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9461 4 396 3.40.630.10
4ewtD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9389 191 304 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A1S8C4Q0-F1-model_v4 Amidohydrolase 0.978 3 170 GO:0016787
AF-A0A6L6D8G5-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9746 7 167 GO:0016787
AF-T1BH08-F1-model_v4 Peptidase M20, dimerization domain protein 0.9734 189 305 GO:0016787
AF-A0A5K7TWH1-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.9685 3 397 GO:0016787
AF-A0A6I5HGU9-F1-model_v4 Amidohydrolase 0.9684 3 401 GO:0016787
GO:0046872

Map