F330170

General Info

Members Datasets Scaffolds Average Seq Length
218 158 436 124

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0449140|Ga0316574_0449140_160_576
Length 138
Sequence MYIDLVSPVISLFNEGFDMKSDEKLDRVVAEARSAREKRDKSYREQALKMYPHICGRCGREFDRKNLHELTVHHRDHNHDNNPPDGSNWELLCLYCHDNEHQRQLEAQQAVNPSGSAKSTGATFNPFENLRGMLDKEK

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
132 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 2547132512 Azospira oryzae 6a3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.46
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.38
Rhizosphere 98.17
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0449140 3300035398 Bacteria 808
2 Ga0070683_100325795 3300005329 Bacteria 1462
3 Ga0070683_100358412 3300005329 Bacteria 1389
4 Ga0070670_100128048 3300005331 Bacteria 2191
5 Ga0070666_10272882 3300005335 Bacteria 1201
6 Ga0070680_100225664 3300005336 Bacteria 1581
7 Ga0070682_100517289 3300005337 Bacteria 928
8 Ga0068868_100066024 3300005338 Bacteria 2876
9 Ga0070661_100304740 3300005344 Bacteria 1241
10 Ga0070692_10242647 3300005345 Bacteria 1075
11 Ga0070668_100110525 3300005347 Bacteria 2187
12 Ga0070668_100128183 3300005347 Bacteria 2034
13 Ga0070668_100226963 3300005347 Bacteria 1542
14 Ga0070669_100398507 3300005353 Bacteria 1125
15 Ga0070675_101042964 3300005354 Bacteria 751
16 Ga0070671_100883271 3300005355 Bacteria 780
17 Ga0070674_100709994 3300005356 Bacteria 860
18 Ga0070673_100831109 3300005364 Bacteria 854
19 Ga0070673_101477444 3300005364 Bacteria 641
20 Ga0070659_100110162 3300005366 Bacteria 2222
21 Ga0070667_100031284 3300005367 Bacteria 4438
22 Ga0070709_10019532 3300005434 Bacteria 3919
23 Ga0070714_100068874 3300005435 Bacteria 3054
24 Ga0070714_100324973 3300005435 Bacteria 1439
25 Ga0070713_100137094 3300005436 Bacteria 2163
26 Ga0070711_100025382 3300005439 Bacteria 3877
27 Ga0070663_100003456 3300005455 Bacteria 9106
28 Ga0070663_101527582 3300005455 Bacteria 594
29 Ga0070678_100111427 3300005456 Bacteria 2141
30 Ga0070681_10617968 3300005458 Bacteria 998
31 Ga0070681_10634081 3300005458 Bacteria 983
32 Ga0070707_100108458 3300005468 Bacteria 2693
33 Ga0070707_100119164 3300005468 Bacteria 2562
34 Ga0070698_100895435 3300005471 Bacteria 833
35 Ga0070699_100120898 3300005518 Bacteria 2303
36 Ga0070699_100516556 3300005518 Bacteria 1086
37 Ga0070684_100006766 3300005535 Bacteria 8887
38 Ga0070697_100165378 3300005536 Bacteria 1870
39 Ga0070697_100180936 3300005536 Bacteria 1787
40 Ga0070697_100775739 3300005536 Bacteria 848
41 Ga0068853_100190196 3300005539 Bacteria 1864
42 Ga0070672_100027855 3300005543 Bacteria 4219
43 Ga0070696_100015860 3300005546 Bacteria 5065
44 Ga0070696_100076154 3300005546 Bacteria 2368
45 Ga0070665_100032282 3300005548 Bacteria 5271
46 Ga0070665_100222374 3300005548 Bacteria 1888
47 Ga0068855_100588648 3300005563 Bacteria 1201
48 Ga0070664_100020439 3300005564 Bacteria 5451
49 Ga0070664_100029305 3300005564 Bacteria 4589
50 Ga0070664_100036749 3300005564 Bacteria 4115
51 Ga0070664_100581396 3300005564 Bacteria 1038
52 Ga0070664_101054832 3300005564 Bacteria 765
53 Ga0068854_100769342 3300005578 Bacteria 837
54 Ga0068856_100009744 3300005614 Bacteria 9332
55 Ga0068852_101453757 3300005616 Bacteria 708
56 Ga0068859_100417443 3300005617 Bacteria 1438
57 Ga0068861_100690444 3300005719 Bacteria 947
58 Ga0068851_10003788 3300005834 Bacteria 6765
59 Ga0068863_100054397 3300005841 Bacteria 3792
60 Ga0068863_100356130 3300005841 Bacteria 1426
61 Ga0068858_100108488 3300005842 Bacteria 2591
62 Ga0068858_101974724 3300005842 Bacteria 577
63 Ga0068860_100184565 3300005843 Bacteria 2017
64 Ga0068860_100351053 3300005843 Bacteria 1452
65 Ga0068860_100417281 3300005843 Bacteria 1330
66 Ga0068862_100035457 3300005844 Bacteria 4225
67 Ga0070715_10069316 3300006163 Bacteria 1571
68 Ga0070716_100016223 3300006173 Bacteria 3839
69 Ga0097621_100318009 3300006237 Bacteria 1378
70 Ga0075428_100230487 3300006844 Bacteria 1999
71 Ga0075428_101936252 3300006844 Bacteria 612
72 Ga0075428_102382908 3300006844 Bacteria 544
73 Ga0075430_100268896 3300006846 Bacteria 1411
74 Ga0075430_101395923 3300006846 Bacteria 576
75 Ga0075433_10328291 3300006852 Bacteria 1353
76 Ga0068865_100674785 3300006881 Bacteria 880
77 Ga0075436_100041112 3300006914 Bacteria 3190
78 Ga0097620_100417454 3300006931 Bacteria 1438
79 Ga0075435_100026575 3300007076 Bacteria 4518
80 Ga0105240_10013756 3300009093 Bacteria 11089
81 Ga0105247_11072594 3300009101 Bacteria 634
82 Ga0114129_10195136 3300009147 Bacteria 2746
83 Ga0105241_10001597 3300009174 Bacteria 17323
84 Ga0105248_10024139 3300009177 Bacteria 6757
85 Ga0105248_10173148 3300009177 Bacteria 2433
86 Ga0105248_10901733 3300009177 Bacteria 998
87 Ga0105249_10399270 3300009553 Unclassified 1405
88 Ga0105239_10058461 3300010375 Bacteria 4231
89 Ga0157373_10054675 3300013100 Bacteria 2836
90 Ga0157373_10147985 3300013100 Bacteria 1652
91 Ga0157370_10089647 3300013104 Bacteria 2889
92 Ga0157369_10825038 3300013105 Bacteria 952
93 Ga0157369_11371466 3300013105 Bacteria 720
94 Ga0157374_10747041 3300013296 Bacteria 993
95 Ga0157374_10835893 3300013296 Bacteria 937
96 Ga0157378_12332890 3300013297 Bacteria 587
97 Ga0157378_13280137 3300013297 Bacteria 503
98 Ga0163162_10529716 3300013306 Bacteria 1307
99 Ga0163162_11793958 3300013306 Bacteria 701
100 Ga0157372_10037226 3300013307 Bacteria 5365
101 Ga0157372_10362650 3300013307 Bacteria 1688
102 Ga0163163_10857288 3300014325 Bacteria 972
103 Ga0157380_11499215 3300014326 Bacteria 727
104 Ga0182008_10171529 3300014497 Bacteria 1095
105 Ga0157379_10312134 3300014968 Bacteria 1434
106 Ga0157376_10033809 3300014969 Bacteria 4121
107 Ga0157376_10080736 3300014969 Bacteria 2791
108 Ga0163161_10378599 3300017792 Bacteria 1131
109 Ga0207656_10037402 3300025321 Bacteria 2042
110 Ga0207642_10172718 3300025899 Bacteria 1171
111 Ga0207685_10211443 3300025905 Bacteria 917
112 Ga0207699_10980047 3300025906 Bacteria 625
113 Ga0207645_10081058 3300025907 Bacteria 2080
114 Ga0207645_10093637 3300025907 Bacteria 1933
115 Ga0207654_10194798 3300025911 Bacteria 1331
116 Ga0207707_10200153 3300025912 Bacteria 1741
117 Ga0207707_10529142 3300025912 Bacteria 1003
118 Ga0207695_10105067 3300025913 Bacteria 2812
119 Ga0207695_10289085 3300025913 Bacteria 1532
120 Ga0207671_10385723 3300025914 Bacteria 1113
121 Ga0207663_10050500 3300025916 Bacteria 2585
122 Ga0207660_10156218 3300025917 Bacteria 1756
123 Ga0207657_10000354 3300025919 Bacteria 48891
124 Ga0207649_10321966 3300025920 Bacteria 1136
125 Ga0207652_10076625 3300025921 Bacteria 2917
126 Ga0207652_10168655 3300025921 Bacteria 1964
127 Ga0207646_10079434 3300025922 Bacteria 2933
128 Ga0207681_10567830 3300025923 Bacteria 935
129 Ga0207694_10026918 3300025924 Bacteria 4378
130 Ga0207650_10342545 3300025925 Bacteria 1228
131 Ga0207659_10808876 3300025926 Bacteria 805
132 Ga0207659_11184422 3300025926 Bacteria 657
133 Ga0207659_11277323 3300025926 Bacteria 630
134 Ga0207664_10012105 3300025929 Bacteria 6161
135 Ga0207664_10270211 3300025929 Bacteria 1489
136 Ga0207644_10612530 3300025931 Bacteria 905
137 Ga0207690_10205810 3300025932 Bacteria 1497
138 Ga0207706_10833274 3300025933 Bacteria 782
139 Ga0207665_10058686 3300025939 Bacteria 2602
140 Ga0207691_10041152 3300025940 Bacteria 4268
141 Ga0207691_10200472 3300025940 Bacteria 1737
142 Ga0207711_10790205 3300025941 Bacteria 884
143 Ga0207679_10659148 3300025945 Bacteria 947
144 Ga0207667_10237572 3300025949 Bacteria 1865
145 Ga0207668_10206519 3300025972 Bacteria 1568
146 Ga0207668_10225912 3300025972 Bacteria 1506
147 Ga0207668_10290333 3300025972 Bacteria 1345
148 Ga0207640_10705216 3300025981 Bacteria 866
149 Ga0207658_10059049 3300025986 Bacteria 2857
150 Ga0207677_10203476 3300026023 Bacteria 1575
151 Ga0207678_10006564 3300026067 Bacteria 10313
152 Ga0207702_10106173 3300026078 Bacteria 2488
153 Ga0207702_10855795 3300026078 Bacteria 900
154 Ga0207641_10102736 3300026088 Bacteria 2521
155 Ga0207641_10303772 3300026088 Bacteria 1508
156 Ga0207641_10786474 3300026088 Bacteria 941
157 Ga0207674_10001310 3300026116 Bacteria 32505
158 Ga0207675_101680192 3300026118 Bacteria 655
159 Ga0207683_10204178 3300026121 Bacteria 1797
160 Ga0207698_10084833 3300026142 Bacteria 2569
161 Ga0268265_10134419 3300028380 Bacteria 2061
162 Ga0268264_10430540 3300028381 Bacteria 1274
163 Ga0268264_10730262 3300028381 Bacteria 985
164 Ga0268264_11339719 3300028381 Bacteria 726
165 Ga0265332_10000188 3300031238 Bacteria 50400
166 Ga0316575_10197522 3300031665 Bacteria 837
167 Ga0316575_10213338 3300031665 Bacteria 805
168 Ga0316579_10000645 3300031691 Bacteria 11846
169 Ga0316578_10203226 3300031728 Bacteria 1192
170 Ga0307405_10812264 3300031731 Bacteria 784
171 Ga0307410_10038903 3300031852 Bacteria 3119
172 Ga0307416_102498663 3300032002 Bacteria 615
173 Ga0307411_10142469 3300032005 Bacteria 1769
174 Ga0307415_100126517 3300032126 Bacteria 1927
175 Ga0316583_10021598 3300032133 Bacteria 2308
176 Ga0316593_10000805 3300032168 Bacteria 6277
177 Ga0316574_0289840 3300035398 Bacteria 1042
178 Ga0373937_0706706 3300036401 Bacteria 955
179 Ga0395900_0498061 3300037418 Bacteria 1169
180 Ga0395905_1133966 3300037471 Bacteria 685
181 Ga0316581_0021835 3300037588 Bacteria 1884
182 Ga0242420_005282 3300038996 Bacteria 1994
183 Ga0451577_0037922 3300042876 Bacteria 4336
184 Ga0451577_0049240 3300042876 Bacteria 3763
185 Ga0451577_0132662 3300042876 Bacteria 2235
186 Ga0451577_0211084 3300042876 Bacteria 1754
187 Ga0451577_0969752 3300042876 Bacteria 764
188 Ga0451577_1907198 3300042876 Bacteria 520
189 Ga0453683_0304393 3300044673 Bacteria 1020
190 Ga0453684_0000348 3300044712 Bacteria 192530
191 Ga0453684_0906581 3300044712 Bacteria 944
192 Ga0453684_1296287 3300044712 Bacteria 760
193 Ga0451576_0000057 3300045051 Bacteria 300798
194 Ga0451576_0014643 3300045051 Bacteria 8717
195 Ga0451576_0024212 3300045051 Bacteria 6560
196 Ga0451576_1271042 3300045051 Bacteria 768
197 Ga0495580_0785766 3300046472 Bacteria 618
198 Ga0495633_0237278 3300046558 Bacteria 833
199 Ga0495623_0650521 3300046679 Bacteria 543
200 Ga0496107_0619551 3300048910 Bacteria 799
201 Ga0496112_1786767 3300048915 Bacteria 527
202 Ga0496115_0729791 3300048918 Bacteria 776
203 Ga0501036_0369814 3300049572 Bacteria 1197
204 Ga0501037_0024778 3300049573 Bacteria 4437
205 Ga0501038_0045015 3300049574 Bacteria 3832
206 Ga0501043_1259218 3300049579 Bacteria 517
207 Ga0501046_0188618 3300049580 Bacteria 1539
208 Ga0501047_0153054 3300049581 Bacteria 2181
209 Ga0501070_1458341 3300049586 Bacteria 519
210 Ga0501073_0011590 3300049589 Bacteria 6444
211 Ga0501074_0267470 3300049590 Bacteria 1215
212 Ga0501079_1043522 3300049741 Bacteria 644
213 Ga0501080_0136432 3300049742 Bacteria 2270
214 Ga0501083_0043398 3300049744 Bacteria 3047
215 Ga0501044_0129785 3300049823 Bacteria 2515
216 nmdc:mga0rr50_600868_c1 3300050513 Bacteria 938
217 nmdc:mga08x19_746315_c1 3300050514 Bacteria 695
218 2548848917 2547132512 Bacteria 3416496
219 Ga0316574_0449140
220 Ga0070683_100325795
221 Ga0070683_100358412
222 Ga0070670_100128048
223 Ga0070666_10272882
224 Ga0070680_100225664
225 Ga0070682_100517289
226 Ga0068868_100066024
227 Ga0070661_100304740
228 Ga0070692_10242647
229 Ga0070668_100110525
230 Ga0070668_100128183
231 Ga0070668_100226963
232 Ga0070669_100398507
233 Ga0070675_101042964
234 Ga0070671_100883271
235 Ga0070674_100709994
236 Ga0070673_100831109
237 Ga0070673_101477444
238 Ga0070659_100110162
239 Ga0070667_100031284
240 Ga0070709_10019532
241 Ga0070714_100068874
242 Ga0070714_100324973
243 Ga0070713_100137094
244 Ga0070711_100025382
245 Ga0070663_100003456
246 Ga0070663_101527582
247 Ga0070678_100111427
248 Ga0070681_10617968
249 Ga0070681_10634081
250 Ga0070707_100108458
251 Ga0070707_100119164
252 Ga0070698_100895435
253 Ga0070699_100120898
254 Ga0070699_100516556
255 Ga0070684_100006766
256 Ga0070697_100165378
257 Ga0070697_100180936
258 Ga0070697_100775739
259 Ga0068853_100190196
260 Ga0070672_100027855
261 Ga0070696_100015860
262 Ga0070696_100076154
263 Ga0070665_100032282
264 Ga0070665_100222374
265 Ga0068855_100588648
266 Ga0070664_100020439
267 Ga0070664_100029305
268 Ga0070664_100036749
269 Ga0070664_100581396
270 Ga0070664_101054832
271 Ga0068854_100769342
272 Ga0068856_100009744
273 Ga0068852_101453757
274 Ga0068859_100417443
275 Ga0068861_100690444
276 Ga0068851_10003788
277 Ga0068863_100054397
278 Ga0068863_100356130
279 Ga0068858_100108488
280 Ga0068858_101974724
281 Ga0068860_100184565
282 Ga0068860_100351053
283 Ga0068860_100417281
284 Ga0068862_100035457
285 Ga0070715_10069316
286 Ga0070716_100016223
287 Ga0097621_100318009
288 Ga0075428_100230487
289 Ga0075428_101936252
290 Ga0075428_102382908
291 Ga0075430_100268896
292 Ga0075430_101395923
293 Ga0075433_10328291
294 Ga0068865_100674785
295 Ga0075436_100041112
296 Ga0097620_100417454
297 Ga0075435_100026575
298 Ga0105240_10013756
299 Ga0105247_11072594
300 Ga0114129_10195136
301 Ga0105241_10001597
302 Ga0105248_10024139
303 Ga0105248_10173148
304 Ga0105248_10901733
305 Ga0105249_10399270
306 Ga0105239_10058461
307 Ga0157373_10054675
308 Ga0157373_10147985
309 Ga0157370_10089647
310 Ga0157369_10825038
311 Ga0157369_11371466
312 Ga0157374_10747041
313 Ga0157374_10835893
314 Ga0157378_12332890
315 Ga0157378_13280137
316 Ga0163162_10529716
317 Ga0163162_11793958
318 Ga0157372_10037226
319 Ga0157372_10362650
320 Ga0163163_10857288
321 Ga0157380_11499215
322 Ga0182008_10171529
323 Ga0157379_10312134
324 Ga0157376_10033809
325 Ga0157376_10080736
326 Ga0163161_10378599
327 Ga0207656_10037402
328 Ga0207642_10172718
329 Ga0207685_10211443
330 Ga0207699_10980047
331 Ga0207645_10081058
332 Ga0207645_10093637
333 Ga0207654_10194798
334 Ga0207707_10200153
335 Ga0207707_10529142
336 Ga0207695_10105067
337 Ga0207695_10289085
338 Ga0207671_10385723
339 Ga0207663_10050500
340 Ga0207660_10156218
341 Ga0207657_10000354
342 Ga0207649_10321966
343 Ga0207652_10076625
344 Ga0207652_10168655
345 Ga0207646_10079434
346 Ga0207681_10567830
347 Ga0207694_10026918
348 Ga0207650_10342545
349 Ga0207659_10808876
350 Ga0207659_11184422
351 Ga0207659_11277323
352 Ga0207664_10012105
353 Ga0207664_10270211
354 Ga0207644_10612530
355 Ga0207690_10205810
356 Ga0207706_10833274
357 Ga0207665_10058686
358 Ga0207691_10041152
359 Ga0207691_10200472
360 Ga0207711_10790205
361 Ga0207679_10659148
362 Ga0207667_10237572
363 Ga0207668_10206519
364 Ga0207668_10225912
365 Ga0207668_10290333
366 Ga0207640_10705216
367 Ga0207658_10059049
368 Ga0207677_10203476
369 Ga0207678_10006564
370 Ga0207702_10106173
371 Ga0207702_10855795
372 Ga0207641_10102736
373 Ga0207641_10303772
374 Ga0207641_10786474
375 Ga0207674_10001310
376 Ga0207675_101680192
377 Ga0207683_10204178
378 Ga0207698_10084833
379 Ga0268265_10134419
380 Ga0268264_10430540
381 Ga0268264_10730262
382 Ga0268264_11339719
383 Ga0265332_10000188
384 Ga0316575_10197522
385 Ga0316575_10213338
386 Ga0316579_10000645
387 Ga0316578_10203226
388 Ga0307405_10812264
389 Ga0307410_10038903
390 Ga0307416_102498663
391 Ga0307411_10142469
392 Ga0307415_100126517
393 Ga0316583_10021598
394 Ga0316593_10000805
395 Ga0316574_0289840
396 Ga0373937_0706706
397 Ga0395900_0498061
398 Ga0395905_1133966
399 Ga0316581_0021835
400 Ga0242420_005282
401 Ga0451577_0037922
402 Ga0451577_0049240
403 Ga0451577_0132662
404 Ga0451577_0211084
405 Ga0451577_0969752
406 Ga0451577_1907198
407 Ga0453683_0304393
408 Ga0453684_0000348
409 Ga0453684_0906581
410 Ga0453684_1296287
411 Ga0451576_0000057
412 Ga0451576_0014643
413 Ga0451576_0024212
414 Ga0451576_1271042
415 Ga0495580_0785766
416 Ga0495633_0237278
417 Ga0495623_0650521
418 Ga0496107_0619551
419 Ga0496112_1786767
420 Ga0496115_0729791
421 Ga0501036_0369814
422 Ga0501037_0024778
423 Ga0501038_0045015
424 Ga0501043_1259218
425 Ga0501046_0188618
426 Ga0501047_0153054
427 Ga0501070_1458341
428 Ga0501073_0011590
429 Ga0501074_0267470
430 Ga0501079_1043522
431 Ga0501080_0136432
432 Ga0501083_0043398
433 Ga0501044_0129785
434 nmdc:mga0rr50_600868_c1
435 nmdc:mga08x19_746315_c1
436 2548848917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01844

HNH

HNH endonuclease

55

103

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qr8-assembly1.cif.gz_B spcas9 bound to ptprc off-target1 dna substrate 0.6788 35 75
6o56-assembly2.cif.gz_B hnh nuclease from s. pyogenes cas9 0.6688 35 74
5zmm-assembly1.cif.gz_B structure of the type iv phosphorothioation-dependent restriction endonuclease scomcra 0.5027 29 79
4h9d-assembly1.cif.gz_A crystal structure of mn-dependent gme hnh nicking endonuclease from geobacter metallireducens gs-15, northeast structural genomics consortium (nesg) target gmr87 0.485 20 96
7ls2-assembly1.cif.gz_D3 80s ribosome from mouse bound to eef2 (class i) 0.474 33 91
ID Description Score Start End Superfamily
af_Q2FYC4_2_103_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.5416 23 90 1.10.30.50
af_P24200_175_274_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.4799 23 117 1.10.30.50
af_Q5YLY5_326_413_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.4564 35 96 3.30.40.10
6az1Y00 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;Ribosomal protein S21 0.4155 30 102 3.30.1230.20
6okkZ00 Alpha Beta;2-Layer Sandwich;Hypothetical Cytosolic Protein; Chain: A;;Ribosomal protein S21 0.413 33 98 3.30.1230.20
ID Description Score Start End GO Terms
AF-A0A8A5VYK2-F1-model_v4 deleted 1.004 25 83
AF-A0A8A5VYK2-F1-model_v4 deleted 0.9876 25 83
AF-A0A8A5VB05-F1-model_v4 deleted 0.9871 22 88
AF-A0A5N8HNZ3-F1-model_v4 Putative HNH nuclease YajD 0.9832 22 78 GO:0003676
GO:0004519
GO:0005829
GO:0008270
AF-A0A2K2VWQ5-F1-model_v4 Putative HNH nuclease YajD 0.9785 3 81 GO:0003676
GO:0004519
GO:0005829
GO:0008270

Map