F330137

General Info

Members Datasets Scaffolds Average Seq Length
218 146 436 169

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10174057|Ga0307406_101740573
Length 170
Sequence MDPIVDVLVETTQGSKHKYEYDHQRRAMRLDRRLYSAVSFPADYGFVAGTEGADGEPLDALVLLEDPTFPGCWVRARVVGVFWIRYDKEGESRREAKLITVAEGDPNFEEVQDLDQLPDHLLSELENFFDVYKMLEPGTSPVPDGYEGRQAALREVEAARDRAGRPPAPE

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
40 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
41 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
52 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
53 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
54 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
55 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
56 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
62 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
63 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
64 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
65 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
66 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
67 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
68 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
69 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.63
Nodule 0
Rhizoplane 1.83
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10174057 3300031901 Bacteria 1561
2 JGI25406J46586_10111387 3300003203 Bacteria 810
3 JGI25407J50210_10000036 3300003373 Bacteria 14603
4 JGI25405J52794_10009308 3300003911 Bacteria 1853
5 Ga0070676_10183725 3300005328 Bacteria 1361
6 Ga0070689_100189829 3300005340 Bacteria 1673
7 Ga0070659_100395968 3300005366 Bacteria 1165
8 Ga0070667_100675024 3300005367 Bacteria 955
9 Ga0070700_101044205 3300005441 Bacteria 674
10 Ga0070678_100498467 3300005456 Bacteria 1074
11 Ga0070665_100583541 3300005548 Bacteria 1131
12 Ga0068860_100332189 3300005843 Bacteria 1493
13 Ga0081455_10002113 3300005937 Bacteria 23655
14 Ga0081455_10304444 3300005937 Bacteria 1142
15 Ga0081538_10001392 3300005981 Bacteria 24810
16 Ga0081538_10017357 3300005981 Bacteria 5466
17 Ga0081538_10021298 3300005981 Bacteria 4737
18 Ga0075365_10007921 3300006038 Bacteria 5987
19 Ga0075365_10248903 3300006038 Bacteria 1249
20 Ga0075365_10381431 3300006038 Bacteria 994
21 Ga0075365_10601577 3300006038 Bacteria 777
22 Ga0075363_100015201 3300006048 Bacteria 3778
23 Ga0075363_100117803 3300006048 Bacteria 1481
24 Ga0075364_10008227 3300006051 Bacteria 6228
25 Ga0075364_10035837 3300006051 Bacteria 3207
26 Ga0075364_10371005 3300006051 Bacteria 976
27 Ga0075367_10350966 3300006178 Bacteria 931
28 Ga0075367_10417080 3300006178 Bacteria 850
29 Ga0075428_100525256 3300006844 Bacteria 1266
30 Ga0075430_100035984 3300006846 Bacteria 4198
31 Ga0075431_100031798 3300006847 Bacteria 5436
32 Ga0075431_100560192 3300006847 Bacteria 1130
33 Ga0075429_100025162 3300006880 Bacteria 5167
34 Ga0105245_10006524 3300009098 Bacteria 10249
35 Ga0105245_10044503 3300009098 Bacteria 3962
36 Ga0114129_10022288 3300009147 Bacteria 8992
37 Ga0105242_10140423 3300009176 Bacteria 2095
38 Ga0105248_11067155 3300009177 Bacteria 913
39 Ga0157374_10843902 3300013296 Bacteria 933
40 Ga0157378_10857393 3300013297 Bacteria 937
41 Ga0157380_10382668 3300014326 Bacteria 1328
42 Ga0157379_10334567 3300014968 Bacteria 1384
43 Ga0207645_10191907 3300025907 Bacteria 1343
44 Ga0207645_10383660 3300025907 Bacteria 943
45 Ga0207654_10695529 3300025911 Bacteria 730
46 Ga0207687_10020204 3300025927 Bacteria 4417
47 Ga0207686_10363448 3300025934 Bacteria 1093
48 Ga0207675_101398981 3300026118 Bacteria 720
49 Ga0209813_10119629 3300027866 Bacteria 915
50 Ga0268264_10018484 3300028381 Bacteria 5700
51 Ga0307408_100454555 3300031548 Bacteria 1112
52 Ga0316576_10164838 3300031727 Bacteria 1672
53 Ga0307405_10046874 3300031731 Bacteria 2659
54 Ga0307405_10406343 3300031731 Bacteria 1067
55 Ga0316577_10364931 3300031733 Bacteria 820
56 Ga0307413_10060195 3300031824 Bacteria 2337
57 Ga0307413_10162922 3300031824 Bacteria 1569
58 Ga0307410_10011132 3300031852 Bacteria 5132
59 Ga0307410_10016158 3300031852 Bacteria 4444
60 Ga0307410_10314699 3300031852 Bacteria 1240
61 Ga0307407_10020887 3300031903 Bacteria 3365
62 Ga0307407_10099704 3300031903 Bacteria 1800
63 Ga0307407_10191871 3300031903 Bacteria 1362
64 Ga0307412_10487041 3300031911 Bacteria 1024
65 Ga0307409_100012460 3300031995 Bacteria 5419
66 Ga0307409_100014557 3300031995 Bacteria 5123
67 Ga0307409_100130205 3300031995 Bacteria 2148
68 Ga0307409_100644736 3300031995 Bacteria 1052
69 Ga0307416_100035030 3300032002 Bacteria 3828
70 Ga0307416_100278802 3300032002 Bacteria 1647
71 Ga0307416_100318797 3300032002 Bacteria 1555
72 Ga0307416_100525536 3300032002 Bacteria 1252
73 Ga0307416_100611638 3300032002 Bacteria 1171
74 Ga0307416_101103015 3300032002 Bacteria 898
75 Ga0307416_101644408 3300032002 Bacteria 747
76 Ga0307414_10018443 3300032004 Bacteria 4297
77 Ga0307414_10144367 3300032004 Bacteria 1868
78 Ga0307411_10042028 3300032005 Bacteria 2914
79 Ga0307411_10083282 3300032005 Bacteria 2209
80 Ga0307411_10829724 3300032005 Bacteria 816
81 Ga0307415_100031300 3300032126 Bacteria 3426
82 Ga0307415_100044097 3300032126 Bacteria 2980
83 Ga0307415_100054682 3300032126 Bacteria 2727
84 Ga0307415_100345125 3300032126 Bacteria 1251
85 Ga0307415_100444306 3300032126 Bacteria 1119
86 Ga0373930_0012795 3300034816 Bacteria 1537
87 Ga0373948_0003940 3300034817 Bacteria 2320
88 Ga0373949_0108092 3300035090 Bacteria 769
89 Ga0373936_0189285 3300035113 Bacteria 905
90 Ga0373953_0080599 3300035117 Bacteria 1353
91 Ga0373957_0296355 3300035120 Bacteria 685
92 Ga0316574_0160505 3300035398 Bacteria 1448
93 Ga0316574_0261425 3300035398 Bacteria 1105
94 Ga0373931_0001650 3300035691 Bacteria 9657
95 Ga0373931_0070671 3300035691 Bacteria 1905
96 Ga0373933_0074201 3300035724 Bacteria 2074
97 Ga0373937_0030436 3300036401 Bacteria 4889
98 Ga0316584_0146969 3300036712 Bacteria 1756
99 Ga0439439_0091026 3300041406 Bacteria 833
100 Ga0439447_022784 3300041407 Bacteria 1637
101 Ga0451793_0805037 3300041452 Bacteria 648
102 Ga0451807_1855121 3300041486 Bacteria 907
103 Ga0451837_0418719 3300041494 Bacteria 679
104 Ga0451849_1482698 3300041505 Bacteria 1318
105 Ga0450900_021470 3300042136 Bacteria 902
106 Ga0439434_0037230 3300042435 Bacteria 1489
107 Ga0466967_0659720 3300045976 Bacteria 1035
108 Ga0495590_0263370 3300046457 Unclassified 643
109 Ga0495629_0455507 3300046459 Bacteria 866
110 Ga0495651_0010852 3300046462 Bacteria 7006
111 Ga0495653_0078808 3300046463 Bacteria 2442
112 Ga0495582_0390592 3300046473 Bacteria 802
113 Ga0495584_0457948 3300046491 Bacteria 649
114 Ga0495608_0014697 3300046511 Bacteria 5432
115 Ga0495628_0648222 3300046516 Bacteria 750
116 Ga0495630_0031433 3300046517 Bacteria 3953
117 Ga0495665_0371964 3300046531 Bacteria 727
118 Ga0495586_0072202 3300046535 Bacteria 1887
119 Ga0495587_0038191 3300046536 Bacteria 2880
120 Ga0495621_0149195 3300046539 Bacteria 919
121 Ga0495667_0019012 3300046559 Bacteria 4636
122 Ga0495656_0459690 3300046615 Bacteria 671
123 Ga0495634_0005447 3300046642 Bacteria 9793
124 Ga0495635_0032538 3300046663 Bacteria 3618
125 Ga0495635_0882754 3300046663 Bacteria 573
126 Ga0495588_0250302 3300046674 Bacteria 934
127 Ga0495657_0004986 3300046675 Bacteria 10551
128 Ga0495623_0005561 3300046679 Bacteria 8229
129 Ga0495647_0018098 3300046681 Bacteria 2503
130 Ga0495658_0135759 3300046683 Bacteria 1501
131 Ga0495624_0474636 3300046690 Bacteria 749
132 Ga0495600_0017900 3300046809 Bacteria 4510
133 Ga0495604_0079053 3300047317 Bacteria 2467
134 Ga0495674_0359007 3300047319 Bacteria 1182
135 Ga0495680_0012705 3300047322 Bacteria 7392
136 Ga0495680_0176262 3300047322 Bacteria 1546
137 Ga0495680_0708540 3300047322 Bacteria 664
138 Ga0495675_0407085 3300047444 Bacteria 792
139 Ga0496102_0784530 3300048905 Bacteria 875
140 Ga0496114_0047156 3300048917 Bacteria 3583
141 Ga0501031_0722201 3300049568 Bacteria 639
142 Ga0501033_0000279 3300049570 Bacteria 49249
143 Ga0501034_0004625 3300049571 Bacteria 15250
144 Ga0501034_0898626 3300049571 Bacteria 774
145 Ga0501036_0003818 3300049572 Bacteria 12087
146 Ga0501037_0009446 3300049573 Bacteria 7160
147 Ga0501038_0129440 3300049574 Bacteria 2074
148 Ga0501039_0057662 3300049575 Bacteria 3007
149 Ga0501040_0011547 3300049576 Bacteria 5780
150 Ga0501040_0015202 3300049576 Bacteria 5085
151 Ga0501041_0004428 3300049577 Bacteria 8124
152 Ga0501041_0031504 3300049577 Bacteria 3204
153 Ga0501042_0002579 3300049578 Bacteria 11145
154 Ga0501042_0055154 3300049578 Bacteria 2835
155 Ga0501043_0198227 3300049579 Bacteria 1559
156 Ga0501046_0010551 3300049580 Bacteria 7926
157 Ga0501046_0017458 3300049580 Bacteria 5988
158 Ga0501047_0189902 3300049581 Bacteria 1918
159 Ga0501048_0047947 3300049582 Bacteria 3047
160 Ga0501048_0068811 3300049582 Bacteria 2500
161 Ga0501067_0705579 3300049583 Bacteria 567
162 Ga0501068_0002353 3300049584 Bacteria 10061
163 Ga0501068_0028393 3300049584 Bacteria 3309
164 Ga0501069_0083648 3300049585 Bacteria 1799
165 Ga0501069_0183045 3300049585 Bacteria 1211
166 Ga0501070_0145116 3300049586 Bacteria 1959
167 Ga0501070_0554672 3300049586 Bacteria 919
168 Ga0501071_0013700 3300049587 Bacteria 5531
169 Ga0501071_0019927 3300049587 Bacteria 4658
170 Ga0501071_1147994 3300049587 Bacteria 600
171 Ga0501072_0007051 3300049588 Bacteria 8530
172 Ga0501072_0011363 3300049588 Bacteria 6804
173 Ga0501072_0242080 3300049588 Bacteria 1437
174 Ga0501073_0000464 3300049589 Bacteria 28106
175 Ga0501073_0102433 3300049589 Bacteria 1988
176 Ga0501073_0636712 3300049589 Bacteria 736
177 Ga0501074_0101772 3300049590 Bacteria 2056
178 Ga0501075_0035989 3300049591 Bacteria 3693
179 Ga0501075_0092563 3300049591 Bacteria 2294
180 Ga0501076_0001422 3300049592 Bacteria 16052
181 Ga0501076_0010344 3300049592 Bacteria 6919
182 Ga0501077_0013417 3300049593 Bacteria 5138
183 Ga0501077_0017713 3300049593 Bacteria 4499
184 Ga0501235_140176 3300049669 Bacteria 619
185 Ga0501079_0009776 3300049741 Bacteria 7272
186 Ga0501079_0058041 3300049741 Bacteria 2986
187 Ga0501079_0689945 3300049741 Bacteria 804
188 Ga0501080_0098908 3300049742 Bacteria 2707
189 Ga0501081_0017767 3300049743 Bacteria 4713
190 Ga0501081_0042593 3300049743 Bacteria 3111
191 Ga0501083_0064947 3300049744 Bacteria 2431
192 Ga0501083_0429557 3300049744 Bacteria 860
193 Ga0501045_0002254 3300049824 Bacteria 13088
194 Ga0501045_0003682 3300049824 Bacteria 10537
195 nmdc:mga03n38_313160_c1 3300050490 Bacteria 846
196 nmdc:mga00v17_28918_c1 3300050491 Bacteria 3249
197 nmdc:mga00v17_60085_c1 3300050491 Bacteria 2334
198 nmdc:mga0yw44_385443_c1 3300050492 Bacteria 946
199 nmdc:mga0yw44_818_c1 3300050492 Bacteria 11602
200 nmdc:mga0yw44_89508_c1 3300050492 Bacteria 1942
201 nmdc:mga06z11_235663_c1 3300050494 Bacteria 1073
202 nmdc:mga06z11_358048_c1 3300050494 Bacteria 874
203 nmdc:mga05p37_34928_c1 3300050507 Bacteria 6162
204 nmdc:mga09592_84484_c1 3300050508 Bacteria 2707
205 nmdc:mga0qj67_42960_c1 3300050509 Bacteria 3560
206 nmdc:mga06r32_234194_c1 3300050510 Bacteria 1824
207 nmdc:mga06r32_79463_c1 3300050510 Bacteria 3191
208 nmdc:mga08y16_19879_c1 3300050511 Bacteria 7083
209 Ga0495595_0014214 3300053084 Bacteria 3373
210 Ga0495595_0195605 3300053084 Bacteria 1006
211 Ga0495619_0101223 3300053085 Bacteria 1962
212 Ga0500566_0000813 3300053094 Bacteria 17779
213 Ga0501084_0002038 3300054114 Bacteria 16136
214 Ga0501084_0077601 3300054114 Bacteria 2784
215 Ga0501082_0006385 3300060353 Bacteria 10233
216 Ga0501082_0260168 3300060353 Bacteria 1509
217 Ga0530510_0003804 3300061734 Bacteria 10395
218 Ga0530510_0048744 3300061734 Bacteria 3061
219 Ga0307406_10174057
220 JGI25406J46586_10111387
221 JGI25407J50210_10000036
222 JGI25405J52794_10009308
223 Ga0070676_10183725
224 Ga0070689_100189829
225 Ga0070659_100395968
226 Ga0070667_100675024
227 Ga0070700_101044205
228 Ga0070678_100498467
229 Ga0070665_100583541
230 Ga0068860_100332189
231 Ga0081455_10002113
232 Ga0081455_10304444
233 Ga0081538_10001392
234 Ga0081538_10017357
235 Ga0081538_10021298
236 Ga0075365_10007921
237 Ga0075365_10248903
238 Ga0075365_10381431
239 Ga0075365_10601577
240 Ga0075363_100015201
241 Ga0075363_100117803
242 Ga0075364_10008227
243 Ga0075364_10035837
244 Ga0075364_10371005
245 Ga0075367_10350966
246 Ga0075367_10417080
247 Ga0075428_100525256
248 Ga0075430_100035984
249 Ga0075431_100031798
250 Ga0075431_100560192
251 Ga0075429_100025162
252 Ga0105245_10006524
253 Ga0105245_10044503
254 Ga0114129_10022288
255 Ga0105242_10140423
256 Ga0105248_11067155
257 Ga0157374_10843902
258 Ga0157378_10857393
259 Ga0157380_10382668
260 Ga0157379_10334567
261 Ga0207645_10191907
262 Ga0207645_10383660
263 Ga0207654_10695529
264 Ga0207687_10020204
265 Ga0207686_10363448
266 Ga0207675_101398981
267 Ga0209813_10119629
268 Ga0268264_10018484
269 Ga0307408_100454555
270 Ga0316576_10164838
271 Ga0307405_10046874
272 Ga0307405_10406343
273 Ga0316577_10364931
274 Ga0307413_10060195
275 Ga0307413_10162922
276 Ga0307410_10011132
277 Ga0307410_10016158
278 Ga0307410_10314699
279 Ga0307407_10020887
280 Ga0307407_10099704
281 Ga0307407_10191871
282 Ga0307412_10487041
283 Ga0307409_100012460
284 Ga0307409_100014557
285 Ga0307409_100130205
286 Ga0307409_100644736
287 Ga0307416_100035030
288 Ga0307416_100278802
289 Ga0307416_100318797
290 Ga0307416_100525536
291 Ga0307416_100611638
292 Ga0307416_101103015
293 Ga0307416_101644408
294 Ga0307414_10018443
295 Ga0307414_10144367
296 Ga0307411_10042028
297 Ga0307411_10083282
298 Ga0307411_10829724
299 Ga0307415_100031300
300 Ga0307415_100044097
301 Ga0307415_100054682
302 Ga0307415_100345125
303 Ga0307415_100444306
304 Ga0373930_0012795
305 Ga0373948_0003940
306 Ga0373949_0108092
307 Ga0373936_0189285
308 Ga0373953_0080599
309 Ga0373957_0296355
310 Ga0316574_0160505
311 Ga0316574_0261425
312 Ga0373931_0001650
313 Ga0373931_0070671
314 Ga0373933_0074201
315 Ga0373937_0030436
316 Ga0316584_0146969
317 Ga0439439_0091026
318 Ga0439447_022784
319 Ga0451793_0805037
320 Ga0451807_1855121
321 Ga0451837_0418719
322 Ga0451849_1482698
323 Ga0450900_021470
324 Ga0439434_0037230
325 Ga0466967_0659720
326 Ga0495590_0263370
327 Ga0495629_0455507
328 Ga0495651_0010852
329 Ga0495653_0078808
330 Ga0495582_0390592
331 Ga0495584_0457948
332 Ga0495608_0014697
333 Ga0495628_0648222
334 Ga0495630_0031433
335 Ga0495665_0371964
336 Ga0495586_0072202
337 Ga0495587_0038191
338 Ga0495621_0149195
339 Ga0495667_0019012
340 Ga0495656_0459690
341 Ga0495634_0005447
342 Ga0495635_0032538
343 Ga0495635_0882754
344 Ga0495588_0250302
345 Ga0495657_0004986
346 Ga0495623_0005561
347 Ga0495647_0018098
348 Ga0495658_0135759
349 Ga0495624_0474636
350 Ga0495600_0017900
351 Ga0495604_0079053
352 Ga0495674_0359007
353 Ga0495680_0012705
354 Ga0495680_0176262
355 Ga0495680_0708540
356 Ga0495675_0407085
357 Ga0496102_0784530
358 Ga0496114_0047156
359 Ga0501031_0722201
360 Ga0501033_0000279
361 Ga0501034_0004625
362 Ga0501034_0898626
363 Ga0501036_0003818
364 Ga0501037_0009446
365 Ga0501038_0129440
366 Ga0501039_0057662
367 Ga0501040_0011547
368 Ga0501040_0015202
369 Ga0501041_0004428
370 Ga0501041_0031504
371 Ga0501042_0002579
372 Ga0501042_0055154
373 Ga0501043_0198227
374 Ga0501046_0010551
375 Ga0501046_0017458
376 Ga0501047_0189902
377 Ga0501048_0047947
378 Ga0501048_0068811
379 Ga0501067_0705579
380 Ga0501068_0002353
381 Ga0501068_0028393
382 Ga0501069_0083648
383 Ga0501069_0183045
384 Ga0501070_0145116
385 Ga0501070_0554672
386 Ga0501071_0013700
387 Ga0501071_0019927
388 Ga0501071_1147994
389 Ga0501072_0007051
390 Ga0501072_0011363
391 Ga0501072_0242080
392 Ga0501073_0000464
393 Ga0501073_0102433
394 Ga0501073_0636712
395 Ga0501074_0101772
396 Ga0501075_0035989
397 Ga0501075_0092563
398 Ga0501076_0001422
399 Ga0501076_0010344
400 Ga0501077_0013417
401 Ga0501077_0017713
402 Ga0501235_140176
403 Ga0501079_0009776
404 Ga0501079_0058041
405 Ga0501079_0689945
406 Ga0501080_0098908
407 Ga0501081_0017767
408 Ga0501081_0042593
409 Ga0501083_0064947
410 Ga0501083_0429557
411 Ga0501045_0002254
412 Ga0501045_0003682
413 nmdc:mga03n38_313160_c1
414 nmdc:mga00v17_28918_c1
415 nmdc:mga00v17_60085_c1
416 nmdc:mga0yw44_385443_c1
417 nmdc:mga0yw44_818_c1
418 nmdc:mga0yw44_89508_c1
419 nmdc:mga06z11_235663_c1
420 nmdc:mga06z11_358048_c1
421 nmdc:mga05p37_34928_c1
422 nmdc:mga09592_84484_c1
423 nmdc:mga0qj67_42960_c1
424 nmdc:mga06r32_234194_c1
425 nmdc:mga06r32_79463_c1
426 nmdc:mga08y16_19879_c1
427 Ga0495595_0014214
428 Ga0495595_0195605
429 Ga0495619_0101223
430 Ga0500566_0000813
431 Ga0501084_0002038
432 Ga0501084_0077601
433 Ga0501082_0006385
434 Ga0501082_0260168
435 Ga0530510_0003804
436 Ga0530510_0048744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

7

164

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjz-assembly1.cif.gz_A structure of inorganic pyrophosphatase mutant d97n 0.9607 5 160
3ld3-assembly1.cif.gz_A crystal structure of inorganic phosphatase from anaplasma phagocytophilum at 1.75a resolution 0.9587 5 160
1mjx-assembly1.cif.gz_A structure of inorganic pyrophosphatase mutant d65n 0.9586 5 160
1mjw-assembly1.cif.gz_A structure of inorganic pyrophosphatase mutant d42n 0.9582 5 161
2bqy-assembly1.cif.gz_A inorganic pyrophosphatase from the pathogenic bacterium helicobacter pylori-kinetic and structural properties 0.9553 4 160
ID Description Score Start End Superfamily
1i40A00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9551 5 161 3.90.80.10
3emjE00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.952 7 158 3.90.80.10
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9516 5 162 3.90.80.10
4z71B00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9501 5 160 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9469 1 161 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A840P3A0-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9744 5 162 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A4V6XUN4-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9732 5 162 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A1V4TLJ9-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.973 46 162 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A7K1D0N6-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9718 5 155 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A2P6W1B7-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9714 5 163 GO:0000287
GO:0004427
GO:0005737
GO:0006796

Map