F330048

General Info

Members Datasets Scaffolds Average Seq Length
218 122 436 215

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10313923|Ga0207691_103139232
Length 251
Sequence VNVKICGITRLEDAELVITLGAWGIGFILWPQSKRYVDPAVAAGIARRLRRKVELVGVFVNQPLDEIADLVDVLGLSHVQLHGDEGPAFCQAVAQRTGAKVIKAVRISHAADLREIERFHTDLHLLDTASDSGAYGGTGRTWDWSLLTQRRHKTPYLIAGGLTPENVAEAIAVTHPWGVDVSSGVESAPGIKDPAKLEALFAAVGDHSRAPVAREPEVLVYPPREEDERDTARLARPDGGARPPRPRGARR

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 0
Rhizoplane 3.67
Rhizosphere 92.2
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10313923 3300025940 Bacteria 1345
2 Ga0070658_10539748 3300005327 Bacteria 1009
3 Ga0070683_100025028 3300005329 Bacteria 5354
4 Ga0070683_100052857 3300005329 Bacteria 3764
5 Ga0070683_100366057 3300005329 Bacteria 1373
6 Ga0068869_100543435 3300005334 Bacteria 975
7 Ga0070661_101038585 3300005344 Unclassified 681
8 Ga0070668_100200087 3300005347 Bacteria 1640
9 Ga0070674_100127331 3300005356 Bacteria 1894
10 Ga0070659_100356587 3300005366 Bacteria 1228
11 Ga0070663_100266449 3300005455 Bacteria 1360
12 Ga0070662_100080162 3300005457 Bacteria 2430
13 Ga0070662_100255029 3300005457 Bacteria 1411
14 Ga0070681_10504719 3300005458 Bacteria 1123
15 Ga0070685_10240037 3300005466 Bacteria 1196
16 Ga0070684_100178610 3300005535 Bacteria 1930
17 Ga0070684_100562761 3300005535 Bacteria 1058
18 Ga0070684_100795194 3300005535 Bacteria 884
19 Ga0068853_100759290 3300005539 Bacteria 927
20 Ga0070664_100866720 3300005564 Bacteria 846
21 Ga0068856_101180723 3300005614 Bacteria 782
22 Ga0068859_100859665 3300005617 Bacteria 993
23 Ga0068861_100092606 3300005719 Bacteria 2388
24 Ga0068870_10172486 3300005840 Bacteria 1292
25 Ga0068870_10206812 3300005840 Bacteria 1193
26 Ga0068862_100741747 3300005844 Bacteria 955
27 Ga0081455_10066567 3300005937 Bacteria 3008
28 Ga0081538_10070220 3300005981 Bacteria 1935
29 Ga0081538_10088430 3300005981 Bacteria 1612
30 Ga0081538_10090630 3300005981 Bacteria 1582
31 Ga0081539_10004464 3300005985 Bacteria 15425
32 Ga0075363_100002698 3300006048 Bacteria 7342
33 Ga0075363_100138449 3300006048 Bacteria 1369
34 Ga0075363_100172289 3300006048 Bacteria 1229
35 Ga0075364_10007803 3300006051 Bacteria 6373
36 Ga0075428_100043021 3300006844 Bacteria 4966
37 Ga0075431_100255151 3300006847 Bacteria 1781
38 Ga0075429_100599079 3300006880 Bacteria 966
39 Ga0097620_100859740 3300006931 Bacteria 993
40 Ga0111539_10017607 3300009094 Bacteria 8843
41 Ga0111539_10395735 3300009094 Bacteria 1609
42 Ga0111539_10400843 3300009094 Bacteria 1598
43 Ga0111539_11129011 3300009094 Bacteria 911
44 Ga0105245_10585630 3300009098 Bacteria 1141
45 Ga0105243_10086927 3300009148 Bacteria 2565
46 Ga0105243_10096624 3300009148 Bacteria 2444
47 Ga0105243_11214202 3300009148 Bacteria 768
48 Ga0105238_10531412 3300009551 Bacteria 1179
49 Ga0105249_10175995 3300009553 Bacteria 2078
50 Ga0105249_10388504 3300009553 Bacteria 1423
51 Ga0105246_10959453 3300011119 Bacteria 771
52 Ga0157380_10504576 3300014326 Bacteria 1176
53 Ga0157380_10839953 3300014326 Bacteria 939
54 Ga0157377_10227476 3300014745 Bacteria 1197
55 Ga0157376_10466580 3300014969 Bacteria 1235
56 Ga0207642_10496332 3300025899 Bacteria 747
57 Ga0207688_10461676 3300025901 Bacteria 793
58 Ga0207643_10123853 3300025908 Bacteria 1533
59 Ga0207643_10175210 3300025908 Bacteria 1296
60 Ga0207643_10342336 3300025908 Bacteria 937
61 Ga0207707_10269216 3300025912 Bacteria 1477
62 Ga0207681_10532862 3300025923 Bacteria 965
63 Ga0207659_10544212 3300025926 Bacteria 986
64 Ga0207687_10087871 3300025927 Bacteria 2260
65 Ga0207687_10346473 3300025927 Bacteria 1209
66 Ga0207706_10411142 3300025933 Bacteria 1173
67 Ga0207706_10485311 3300025933 Bacteria 1067
68 Ga0207669_10215113 3300025937 Bacteria 1406
69 Ga0207689_10325563 3300025942 Bacteria 1276
70 Ga0207661_10116602 3300025944 Bacteria 2267
71 Ga0207651_10275154 3300025960 Bacteria 1389
72 Ga0207639_10713818 3300026041 Bacteria 931
73 Ga0207708_10019680 3300026075 Bacteria 5091
74 Ga0207648_10215207 3300026089 Bacteria 1707
75 Ga0207675_100033633 3300026118 Bacteria 4776
76 Ga0207675_101239024 3300026118 Bacteria 766
77 Ga0207698_10145516 3300026142 Bacteria 2049
78 Ga0207698_10888507 3300026142 Bacteria 898
79 Ga0207428_10033627 3300027907 Bacteria 4208
80 Ga0307405_10111407 3300031731 Bacteria 1855
81 Ga0307413_10008932 3300031824 Bacteria 4764
82 Ga0307410_10077241 3300031852 Bacteria 2327
83 Ga0307410_10099876 3300031852 Bacteria 2078
84 Ga0307406_10146794 3300031901 Bacteria 1677
85 Ga0307407_10042528 3300031903 Bacteria 2548
86 Ga0307407_10642003 3300031903 Bacteria 794
87 Ga0307412_10336865 3300031911 Bacteria 1206
88 Ga0307409_100030446 3300031995 Bacteria 3877
89 Ga0307409_100141644 3300031995 Bacteria 2073
90 Ga0307409_100495282 3300031995 Bacteria 1189
91 Ga0307409_100735790 3300031995 Bacteria 989
92 Ga0307416_100016317 3300032002 Bacteria 5158
93 Ga0307416_100018887 3300032002 Bacteria 4872
94 Ga0307416_100342109 3300032002 Bacteria 1509
95 Ga0307416_100626563 3300032002 Bacteria 1158
96 Ga0307416_100829827 3300032002 Bacteria 1022
97 Ga0307414_10060604 3300032004 Bacteria 2677
98 Ga0307411_10125468 3300032005 Bacteria 1866
99 Ga0307411_10510872 3300032005 Bacteria 1018
100 Ga0307415_100000918 3300032126 Bacteria 13503
101 Ga0307415_100016005 3300032126 Bacteria 4456
102 Ga0307415_100223808 3300032126 Bacteria 1510
103 Ga0307415_100688678 3300032126 Bacteria 921
104 Ga0395900_0772260 3300037418 Bacteria 890
105 Ga0395898_0758124 3300037466 Bacteria 912
106 Ga0395901_0062120 3300038443 Bacteria 3888
107 Ga0451791_0427199 3300041451 Bacteria 1046
108 Ga0451853_2577298 3300041512 Bacteria 1045
109 Ga0466965_0065753 3300044683 Bacteria 1817
110 Ga0466966_0014319 3300044684 Bacteria 5252
111 Ga0466961_0294483 3300044693 Bacteria 992
112 Ga0466963_0021929 3300044694 Bacteria 4038
113 Ga0466963_0036052 3300044694 Bacteria 3224
114 Ga0466963_0102366 3300044694 Bacteria 1961
115 Ga0466963_0133129 3300044694 Bacteria 1719
116 Ga0466963_0288164 3300044694 Bacteria 1154
117 Ga0466963_0563363 3300044694 Bacteria 805
118 Ga0466964_0053340 3300044706 Bacteria 1664
119 Ga0466964_0152378 3300044706 Bacteria 1073
120 Ga0466964_0301385 3300044706 Unclassified 808
121 Ga0466971_0089083 3300044719 Bacteria 1412
122 Ga0466970_0108364 3300044765 Bacteria 1516
123 Ga0466957_0214058 3300044842 Bacteria 1270
124 Ga0466957_0681458 3300044842 Bacteria 724
125 Ga0466960_0000491 3300044901 Bacteria 13495
126 Ga0466960_0122482 3300044901 Bacteria 1364
127 Ga0466960_0163469 3300044901 Bacteria 1197
128 Ga0466958_0184296 3300045836 Bacteria 1325
129 Ga0466967_0015203 3300045976 Bacteria 6027
130 Ga0466967_0020376 3300045976 Bacteria 5358
131 Ga0466967_0056951 3300045976 Bacteria 3448
132 Ga0466967_0175428 3300045976 Bacteria 2019
133 Ga0466967_0239189 3300045976 Bacteria 1731
134 Ga0466967_0243236 3300045976 Bacteria 1717
135 Ga0466967_0289510 3300045976 Bacteria 1573
136 Ga0466967_0293902 3300045976 Bacteria 1561
137 Ga0466967_0416384 3300045976 Bacteria 1309
138 Ga0466967_0486870 3300045976 Bacteria 1209
139 Ga0466967_0524496 3300045976 Bacteria 1164
140 Ga0466967_0580365 3300045976 Bacteria 1105
141 Ga0466967_0644353 3300045976 Bacteria 1047
142 Ga0466967_0680719 3300045976 Bacteria 1018
143 Ga0466967_1271676 3300045976 Bacteria 733
144 Ga0496109_0586988 3300048912 Bacteria 1050
145 Ga0496110_0446817 3300048913 Bacteria 1178
146 Ga0496111_0104574 3300048914 Bacteria 2083
147 Ga0496112_0060919 3300048915 Bacteria 3719
148 Ga0496112_0090552 3300048915 Bacteria 3028
149 Ga0496113_0156707 3300048916 Bacteria 1799
150 Ga0496114_0923043 3300048917 Unclassified 755
151 Ga0496121_0254912 3300048924 Bacteria 1215
152 Ga0501031_0013391 3300049568 Bacteria 5351
153 Ga0501031_0079188 3300049568 Bacteria 2141
154 Ga0501031_0361758 3300049568 Bacteria 939
155 Ga0501034_0016448 3300049571 Bacteria 7591
156 Ga0501034_0178369 3300049571 Bacteria 2090
157 Ga0501036_0067175 3300049572 Bacteria 3033
158 Ga0501036_0119170 3300049572 Bacteria 2229
159 Ga0501036_0272000 3300049572 Bacteria 1418
160 Ga0501038_0055264 3300049574 Bacteria 3411
161 Ga0501038_0126993 3300049574 Bacteria 2098
162 Ga0501039_0218812 3300049575 Bacteria 1497
163 Ga0501039_0285511 3300049575 Bacteria 1297
164 Ga0501039_0509741 3300049575 Bacteria 944
165 Ga0501040_0010569 3300049576 Bacteria 6036
166 Ga0501040_0026954 3300049576 Bacteria 3866
167 Ga0501040_0166358 3300049576 Bacteria 1560
168 Ga0501041_0008670 3300049577 Bacteria 5989
169 Ga0501041_0078869 3300049577 Bacteria 2027
170 Ga0501042_0043423 3300049578 Bacteria 3201
171 Ga0501042_0072322 3300049578 Bacteria 2467
172 Ga0501046_0240625 3300049580 Bacteria 1335
173 Ga0501046_0261531 3300049580 Bacteria 1271
174 Ga0501047_0077842 3300049581 Bacteria 3189
175 Ga0501048_0008471 3300049582 Bacteria 7776
176 Ga0501048_0046909 3300049582 Bacteria 3084
177 Ga0501048_0079751 3300049582 Bacteria 2310
178 Ga0501048_0168417 3300049582 Bacteria 1551
179 Ga0501068_0052018 3300049584 Bacteria 2479
180 Ga0501068_0368134 3300049584 Bacteria 925
181 Ga0501071_0040789 3300049587 Bacteria 3323
182 Ga0501071_0047137 3300049587 Bacteria 3096
183 Ga0501071_0203825 3300049587 Bacteria 1486
184 Ga0501072_0021679 3300049588 Bacteria 4983
185 Ga0501072_0027652 3300049588 Bacteria 4424
186 Ga0501072_0045912 3300049588 Bacteria 3436
187 Ga0501073_0313712 3300049589 Bacteria 1082
188 Ga0501074_0039164 3300049590 Bacteria 3433
189 Ga0501074_0068105 3300049590 Bacteria 2559
190 Ga0501074_0138765 3300049590 Bacteria 1739
191 Ga0501075_0061401 3300049591 Bacteria 2832
192 Ga0501076_0067258 3300049592 Bacteria 2861
193 Ga0501076_0070033 3300049592 Bacteria 2803
194 Ga0501076_0817965 3300049592 Bacteria 769
195 Ga0501077_0036590 3300049593 Bacteria 3128
196 Ga0501077_0054521 3300049593 Bacteria 2539
197 Ga0501079_0022517 3300049741 Bacteria 4832
198 Ga0501079_0161963 3300049741 Bacteria 1745
199 Ga0501081_0013111 3300049743 Bacteria 5450
200 Ga0501081_0095170 3300049743 Bacteria 2099
201 Ga0501035_0115430 3300049822 Bacteria 2350
202 Ga0501045_0028573 3300049824 Bacteria 4024
203 Ga0501045_0161019 3300049824 Bacteria 1670
204 nmdc:mga03n38_85403_c1 3300050490 Bacteria 1492
205 nmdc:mga0yw44_270334_c1 3300050492 Bacteria 1134
206 nmdc:mga08y16_409510_c1 3300050511 Bacteria 1387
207 nmdc:mga08y16_522879_c1 3300050511 Bacteria 1203
208 nmdc:mga08y16_8138_c1 3300050511 Bacteria 10969
209 Ga0500616_0146666 3300053153 Bacteria 1097
210 Ga0501084_0078270 3300054114 Bacteria 2771
211 Ga0501084_0078605 3300054114 Bacteria 2765
212 Ga0590077_064152 3300059426 Bacteria 835
213 Ga0501082_0106024 3300060353 Bacteria 2431
214 Ga0501082_0346151 3300060353 Bacteria 1295
215 Ga0466962_0083593 3300061719 Bacteria 1527
216 Ga0530510_0027057 3300061734 Bacteria 4108
217 Ga0530510_0093105 3300061734 Bacteria 2200
218 Ga0530510_0110961 3300061734 Bacteria 2009
219 Ga0207691_10313923
220 Ga0070658_10539748
221 Ga0070683_100025028
222 Ga0070683_100052857
223 Ga0070683_100366057
224 Ga0068869_100543435
225 Ga0070661_101038585
226 Ga0070668_100200087
227 Ga0070674_100127331
228 Ga0070659_100356587
229 Ga0070663_100266449
230 Ga0070662_100080162
231 Ga0070662_100255029
232 Ga0070681_10504719
233 Ga0070685_10240037
234 Ga0070684_100178610
235 Ga0070684_100562761
236 Ga0070684_100795194
237 Ga0068853_100759290
238 Ga0070664_100866720
239 Ga0068856_101180723
240 Ga0068859_100859665
241 Ga0068861_100092606
242 Ga0068870_10172486
243 Ga0068870_10206812
244 Ga0068862_100741747
245 Ga0081455_10066567
246 Ga0081538_10070220
247 Ga0081538_10088430
248 Ga0081538_10090630
249 Ga0081539_10004464
250 Ga0075363_100002698
251 Ga0075363_100138449
252 Ga0075363_100172289
253 Ga0075364_10007803
254 Ga0075428_100043021
255 Ga0075431_100255151
256 Ga0075429_100599079
257 Ga0097620_100859740
258 Ga0111539_10017607
259 Ga0111539_10395735
260 Ga0111539_10400843
261 Ga0111539_11129011
262 Ga0105245_10585630
263 Ga0105243_10086927
264 Ga0105243_10096624
265 Ga0105243_11214202
266 Ga0105238_10531412
267 Ga0105249_10175995
268 Ga0105249_10388504
269 Ga0105246_10959453
270 Ga0157380_10504576
271 Ga0157380_10839953
272 Ga0157377_10227476
273 Ga0157376_10466580
274 Ga0207642_10496332
275 Ga0207688_10461676
276 Ga0207643_10123853
277 Ga0207643_10175210
278 Ga0207643_10342336
279 Ga0207707_10269216
280 Ga0207681_10532862
281 Ga0207659_10544212
282 Ga0207687_10087871
283 Ga0207687_10346473
284 Ga0207706_10411142
285 Ga0207706_10485311
286 Ga0207669_10215113
287 Ga0207689_10325563
288 Ga0207661_10116602
289 Ga0207651_10275154
290 Ga0207639_10713818
291 Ga0207708_10019680
292 Ga0207648_10215207
293 Ga0207675_100033633
294 Ga0207675_101239024
295 Ga0207698_10145516
296 Ga0207698_10888507
297 Ga0207428_10033627
298 Ga0307405_10111407
299 Ga0307413_10008932
300 Ga0307410_10077241
301 Ga0307410_10099876
302 Ga0307406_10146794
303 Ga0307407_10042528
304 Ga0307407_10642003
305 Ga0307412_10336865
306 Ga0307409_100030446
307 Ga0307409_100141644
308 Ga0307409_100495282
309 Ga0307409_100735790
310 Ga0307416_100016317
311 Ga0307416_100018887
312 Ga0307416_100342109
313 Ga0307416_100626563
314 Ga0307416_100829827
315 Ga0307414_10060604
316 Ga0307411_10125468
317 Ga0307411_10510872
318 Ga0307415_100000918
319 Ga0307415_100016005
320 Ga0307415_100223808
321 Ga0307415_100688678
322 Ga0395900_0772260
323 Ga0395898_0758124
324 Ga0395901_0062120
325 Ga0451791_0427199
326 Ga0451853_2577298
327 Ga0466965_0065753
328 Ga0466966_0014319
329 Ga0466961_0294483
330 Ga0466963_0021929
331 Ga0466963_0036052
332 Ga0466963_0102366
333 Ga0466963_0133129
334 Ga0466963_0288164
335 Ga0466963_0563363
336 Ga0466964_0053340
337 Ga0466964_0152378
338 Ga0466964_0301385
339 Ga0466971_0089083
340 Ga0466970_0108364
341 Ga0466957_0214058
342 Ga0466957_0681458
343 Ga0466960_0000491
344 Ga0466960_0122482
345 Ga0466960_0163469
346 Ga0466958_0184296
347 Ga0466967_0015203
348 Ga0466967_0020376
349 Ga0466967_0056951
350 Ga0466967_0175428
351 Ga0466967_0239189
352 Ga0466967_0243236
353 Ga0466967_0289510
354 Ga0466967_0293902
355 Ga0466967_0416384
356 Ga0466967_0486870
357 Ga0466967_0524496
358 Ga0466967_0580365
359 Ga0466967_0644353
360 Ga0466967_0680719
361 Ga0466967_1271676
362 Ga0496109_0586988
363 Ga0496110_0446817
364 Ga0496111_0104574
365 Ga0496112_0060919
366 Ga0496112_0090552
367 Ga0496113_0156707
368 Ga0496114_0923043
369 Ga0496121_0254912
370 Ga0501031_0013391
371 Ga0501031_0079188
372 Ga0501031_0361758
373 Ga0501034_0016448
374 Ga0501034_0178369
375 Ga0501036_0067175
376 Ga0501036_0119170
377 Ga0501036_0272000
378 Ga0501038_0055264
379 Ga0501038_0126993
380 Ga0501039_0218812
381 Ga0501039_0285511
382 Ga0501039_0509741
383 Ga0501040_0010569
384 Ga0501040_0026954
385 Ga0501040_0166358
386 Ga0501041_0008670
387 Ga0501041_0078869
388 Ga0501042_0043423
389 Ga0501042_0072322
390 Ga0501046_0240625
391 Ga0501046_0261531
392 Ga0501047_0077842
393 Ga0501048_0008471
394 Ga0501048_0046909
395 Ga0501048_0079751
396 Ga0501048_0168417
397 Ga0501068_0052018
398 Ga0501068_0368134
399 Ga0501071_0040789
400 Ga0501071_0047137
401 Ga0501071_0203825
402 Ga0501072_0021679
403 Ga0501072_0027652
404 Ga0501072_0045912
405 Ga0501073_0313712
406 Ga0501074_0039164
407 Ga0501074_0068105
408 Ga0501074_0138765
409 Ga0501075_0061401
410 Ga0501076_0067258
411 Ga0501076_0070033
412 Ga0501076_0817965
413 Ga0501077_0036590
414 Ga0501077_0054521
415 Ga0501079_0022517
416 Ga0501079_0161963
417 Ga0501081_0013111
418 Ga0501081_0095170
419 Ga0501035_0115430
420 Ga0501045_0028573
421 Ga0501045_0161019
422 nmdc:mga03n38_85403_c1
423 nmdc:mga0yw44_270334_c1
424 nmdc:mga08y16_409510_c1
425 nmdc:mga08y16_522879_c1
426 nmdc:mga08y16_8138_c1
427 Ga0500616_0146666
428 Ga0501084_0078270
429 Ga0501084_0078605
430 Ga0590077_064152
431 Ga0501082_0106024
432 Ga0501082_0346151
433 Ga0466962_0083593
434 Ga0530510_0027057
435 Ga0530510_0093105
436 Ga0530510_0110961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

3

203

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9436 1 205
1v5x-assembly1.cif.gz_B crystal structure of phosphoribosyl anthranilate isomerase from thermus thermophilus 0.9414 1 205
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9294 1 205
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9292 1 205
1v5x-assembly1.cif.gz_B crystal structure of phosphoribosyl anthranilate isomerase from thermus thermophilus 0.9278 1 205
ID Description Score Start End Superfamily
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9414 1 205 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9278 1 205 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9186 1 204 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9185 6 199 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9045 6 199 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7V9HRX4-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9881 1 208 GO:0000162
GO:0004640
GO:0006568
AF-A0A838UYB3-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.988 1 204 GO:0000162
GO:0004640
GO:0006568
AF-A0A7J9YSZ1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9847 1 206 GO:0000162
GO:0004640
GO:0006568
AF-A0A537YV11-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9842 1 208 GO:0000162
GO:0004640
GO:0006568
AF-A0A6J7II88-F1-model_v4 phosphoribosylanthranilate isomerase (EC 5.3.1.24) 0.9829 4 206 GO:0000162
GO:0004640
GO:0006568

Map