F330041

General Info

Members Datasets Scaffolds Average Seq Length
218 151 436 211

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10074492|Ga0207670_100744923
Length 235
Sequence MQAPGPWPVPEGWHADRIVGFEPEGATLTDVLDRTAADSDANEHAPLPDPALANIAGHVRAILAELGLDLTDPNLRETDRRVARMYAEMFSGLREGSRPQVTCFPNDEGYRAMVMEKEIPFYSMCAHHLVPFYGHAHMAYIPNDRILGLSKFARILEFYAKRPQLQERLTEQIVGFIEQELKPQGAMVVIEARHLCVEMRGVKKPGAVTVTSAIRGTFYKKEVREEFLDLLRRGA

Samples

Sample ID Description Type Environment
1 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
98 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
103 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
104 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
105 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
106 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
107 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
151 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.88
Rhizosphere 89.91
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207670_10074492 3300025936 Bacteria 2357
2 rootH1_10189202 3300003323 Unclassified 3152
3 Ga0070658_10162216 3300005327 Bacteria 1876
4 Ga0070676_10236644 3300005328 Bacteria 1213
5 Ga0070690_100095009 3300005330 Bacteria 1968
6 Ga0070666_10004150 3300005335 Bacteria 8791
7 Ga0070682_100487872 3300005337 Bacteria 952
8 Ga0070689_100115259 3300005340 Bacteria 2141
9 Ga0070669_100000067 3300005353 Bacteria 104253
10 Ga0070669_100185843 3300005353 Bacteria 1628
11 Ga0070675_100018131 3300005354 Bacteria 5602
12 Ga0070671_100666869 3300005355 Bacteria 901
13 Ga0070674_100963068 3300005356 Bacteria 747
14 Ga0070673_100100696 3300005364 Bacteria 2379
15 Ga0070673_100131510 3300005364 Bacteria 2100
16 Ga0070673_100383420 3300005364 Bacteria 1253
17 Ga0070659_100232960 3300005366 Bacteria 1522
18 Ga0070667_100000989 3300005367 Bacteria 26078
19 Ga0070709_10000188 3300005434 Bacteria 39098
20 Ga0070709_10145367 3300005434 Bacteria 1633
21 Ga0070708_100024531 3300005445 Bacteria 5147
22 Ga0070678_100051957 3300005456 Unclassified 2973
23 Ga0068867_100006831 3300005459 Bacteria 8069
24 Ga0070672_100002838 3300005543 Bacteria 11106
25 Ga0070686_100114555 3300005544 Bacteria 1842
26 Ga0070696_100660692 3300005546 Bacteria 848
27 Ga0070665_100000192 3300005548 Bacteria 108722
28 Ga0070665_100014555 3300005548 Bacteria 7894
29 Ga0070665_100070368 3300005548 Bacteria 3506
30 Ga0070704_100063118 3300005549 Bacteria 2658
31 Ga0068855_100014633 3300005563 Bacteria 9449
32 Ga0070664_100009457 3300005564 Bacteria 7901
33 Ga0070664_100036194 3300005564 Bacteria 4147
34 Ga0068857_101139499 3300005577 Bacteria 754
35 Ga0068859_100000020 3300005617 Bacteria 247060
36 Ga0068859_100000645 3300005617 Bacteria 34867
37 Ga0068859_100015292 3300005617 Bacteria 7707
38 Ga0068864_100003017 3300005618 Bacteria 13913
39 Ga0068864_100543677 3300005618 Bacteria 1122
40 Ga0068866_10019561 3300005718 Bacteria 3086
41 Ga0068861_100272817 3300005719 Bacteria 1453
42 Ga0068863_100002762 3300005841 Bacteria 17386
43 Ga0068863_100016107 3300005841 Bacteria 7170
44 Ga0068863_100038947 3300005841 Bacteria 4523
45 Ga0068858_100003319 3300005842 Bacteria 16028
46 Ga0068860_100001845 3300005843 Bacteria 22552
47 Ga0068860_100001996 3300005843 Bacteria 21522
48 Ga0068862_100004331 3300005844 Bacteria 12015
49 Ga0097621_100019920 3300006237 Bacteria 5161
50 Ga0097621_100030050 3300006237 Viruses 4298
51 Ga0097621_100575118 3300006237 Bacteria 1028
52 Ga0075428_100038116 3300006844 Bacteria 5290
53 Ga0075428_100093913 3300006844 Bacteria 3270
54 Ga0075428_101230205 3300006844 Bacteria 789
55 Ga0075431_100001271 3300006847 Bacteria 22985
56 Ga0075433_10090762 3300006852 Bacteria 2700
57 Ga0075433_10093767 3300006852 Bacteria 2656
58 Ga0075434_100014264 3300006871 Bacteria 7593
59 Ga0075434_100028714 3300006871 Bacteria 5468
60 Ga0075434_100040842 3300006871 Bacteria 4594
61 Ga0075434_101282211 3300006871 Bacteria 744
62 Ga0075429_100076827 3300006880 Bacteria 2909
63 Ga0075429_100650053 3300006880 Bacteria 924
64 Ga0075436_100000021 3300006914 Bacteria 124572
65 Ga0075436_100022758 3300006914 Bacteria 4305
66 Ga0075436_100085569 3300006914 Unclassified 2189
67 Ga0097620_100000020 3300006931 Bacteria 247060
68 Ga0097620_100000645 3300006931 Bacteria 34867
69 Ga0097620_100015292 3300006931 Bacteria 7707
70 Ga0075435_100010794 3300007076 Bacteria 6688
71 Ga0075435_100122860 3300007076 Bacteria 2167
72 Ga0075435_100173895 3300007076 Bacteria 1818
73 Ga0111539_10995830 3300009094 Bacteria 974
74 Ga0105247_10045820 3300009101 Bacteria 2684
75 Ga0114129_10008054 3300009147 Bacteria 15017
76 Ga0114129_10896347 3300009147 Bacteria 1124
77 Ga0105241_10103088 3300009174 Bacteria 2271
78 Ga0105242_10195809 3300009176 Bacteria 1792
79 Ga0105248_10224305 3300009177 Bacteria 2115
80 Ga0105248_10229331 3300009177 Bacteria 2090
81 Ga0157374_10001464 3300013296 Bacteria 19954
82 Ga0157378_10014040 3300013297 Bacteria 7012
83 Ga0157378_11114193 3300013297 Unclassified 827
84 Ga0157375_10096029 3300013308 Bacteria 3036
85 Ga0157375_10326408 3300013308 Bacteria 1699
86 Ga0163163_10001290 3300014325 Bacteria 21168
87 Ga0163163_10598341 3300014325 Bacteria 1166
88 Ga0157380_10656461 3300014326 Bacteria 1047
89 Ga0157379_10001313 3300014968 Bacteria 20284
90 Ga0157376_10006691 3300014969 Bacteria 8159
91 Ga0157376_10012020 3300014969 Bacteria 6407
92 Ga0157376_10047241 3300014969 Bacteria 3553
93 Ga0207710_10050475 3300025900 Bacteria 1867
94 Ga0207680_10005686 3300025903 Bacteria 5971
95 Ga0207680_10010294 3300025903 Bacteria 4673
96 Ga0207680_10017504 3300025903 Bacteria 3788
97 Ga0207699_10000173 3300025906 Bacteria 39126
98 Ga0207699_10308803 3300025906 Bacteria 1106
99 Ga0207684_10009437 3300025910 Bacteria 8617
100 Ga0207684_10076594 3300025910 Bacteria 2843
101 Ga0207681_10000018 3300025923 Bacteria 278874
102 Ga0207650_10003732 3300025925 Bacteria 10420
103 Ga0207650_10330706 3300025925 Bacteria 1250
104 Ga0207659_10026570 3300025926 Bacteria 3907
105 Ga0207700_10486679 3300025928 Bacteria 1091
106 Ga0207644_10066439 3300025931 Bacteria 2626
107 Ga0207690_10125518 3300025932 Bacteria 1870
108 Ga0207706_10139915 3300025933 Bacteria 2129
109 Ga0207686_10487377 3300025934 Bacteria 954
110 Ga0207704_10658247 3300025938 Bacteria 863
111 Ga0207691_10001818 3300025940 Bacteria 20864
112 Ga0207711_10000511 3300025941 Bacteria 39835
113 Ga0207711_10098626 3300025941 Bacteria 2582
114 Ga0207711_10170428 3300025941 Bacteria 1975
115 Ga0207689_10183702 3300025942 Bacteria 1724
116 Ga0207661_10206364 3300025944 Bacteria 1730
117 Ga0207679_10525178 3300025945 Bacteria 1059
118 Ga0207651_10015193 3300025960 Bacteria 4467
119 Ga0207651_10049338 3300025960 Bacteria 2851
120 Ga0207651_10610490 3300025960 Bacteria 954
121 Ga0207658_10005265 3300025986 Bacteria 8898
122 Ga0207658_10367327 3300025986 Bacteria 1257
123 Ga0207703_10003939 3300026035 Bacteria 12316
124 Ga0207678_10056637 3300026067 Bacteria 3374
125 Ga0207702_10021812 3300026078 Bacteria 5303
126 Ga0207641_10011680 3300026088 Bacteria 7211
127 Ga0207641_10064569 3300026088 Bacteria 3129
128 Ga0207641_10241156 3300026088 Bacteria 1684
129 Ga0207648_10010594 3300026089 Bacteria 8720
130 Ga0207648_10414574 3300026089 Bacteria 1222
131 Ga0207676_10018259 3300026095 Bacteria 5097
132 Ga0207675_100417898 3300026118 Bacteria 1324
133 Ga0207683_10003642 3300026121 Bacteria 13403
134 Ga0207683_11238683 3300026121 Bacteria 691
135 Ga0209998_10021273 3300027717 Bacteria 1392
136 Ga0268266_10000298 3300028379 Bacteria 79989
137 Ga0268266_10002472 3300028379 Bacteria 19757
138 Ga0268266_10035592 3300028379 Bacteria 4236
139 Ga0268265_10013859 3300028380 Bacteria 5487
140 Ga0268264_10001393 3300028381 Bacteria 22617
141 Ga0268264_10003718 3300028381 Bacteria 13110
142 Ga0265332_10059224 3300031238 Bacteria 1639
143 Ga0265329_10026877 3300031242 Bacteria 1893
144 Ga0265316_10024599 3300031344 Bacteria 5040
145 Ga0307508_10004892 3300031616 Bacteria 12887
146 Ga0265314_10228604 3300031711 Bacteria 1081
147 Ga0307406_10000072 3300031901 Viruses 55528
148 Ga0307414_10160308 3300032004 Viruses 1786
149 Ga0373929_0000012 3300035085 Bacteria 169316
150 Ga0373961_0000515 3300035241 Bacteria 14835
151 Ga0373935_0022766 3300035692 Bacteria 3846
152 Ga0373925_0931858 3300037068 Unclassified 716
153 Ga0436365_0787433 3300039437 Bacteria 965
154 Ga0451795_0212239 3300041456 Bacteria 752
155 Ga0451798_1068075 3300041458 Bacteria 858
156 Ga0451807_0920738 3300041486 Bacteria 1527
157 Ga0451833_0522025 3300041491 Bacteria 1306
158 Ga0451845_0301766 3300041501 Bacteria 798
159 Ga0451849_0480959 3300041505 Bacteria 995
160 Ga0451577_0189102 3300042876 Bacteria 1857
161 Ga0466963_0323102 3300044694 Bacteria 1086
162 Ga0453684_0048218 3300044712 Bacteria 5637
163 Ga0453684_0065294 3300044712 Bacteria 4642
164 Ga0453684_0869850 3300044712 Bacteria 967
165 Ga0495629_0131960 3300046459 Bacteria 1740
166 Ga0495580_0193075 3300046472 Bacteria 1404
167 Ga0495582_0039033 3300046473 Unclassified 2614
168 Ga0495585_0018059 3300046492 Bacteria 4070
169 Ga0495594_0357674 3300046499 Bacteria 831
170 Ga0495647_0084492 3300046681 Unclassified 1292
171 Ga0495658_0004839 3300046683 Bacteria 6606
172 Ga0495613_0270686 3300046689 Unclassified 1182
173 Ga0496100_0152131 3300048903 Bacteria 1651
174 Ga0496101_0100132 3300048904 Bacteria 2167
175 Ga0496102_0002697 3300048905 Bacteria 15095
176 Ga0496105_0152676 3300048908 Bacteria 1898
177 Ga0496106_0000977 3300048909 Bacteria 20836
178 Ga0496107_0005498 3300048910 Bacteria 8669
179 Ga0496108_0038168 3300048911 Bacteria 4002
180 Ga0496109_0140240 3300048912 Bacteria 2260
181 Ga0496110_0041896 3300048913 Bacteria 3996
182 Ga0496111_0137564 3300048914 Bacteria 1810
183 Ga0496113_0065710 3300048916 Bacteria 2746
184 Ga0496114_0000028 3300048917 Bacteria 177603
185 Ga0501034_0013680 3300049571 Bacteria 8343
186 Ga0501034_0191190 3300049571 Bacteria 2009
187 Ga0501067_0043692 3300049583 Bacteria 2489
188 Ga0501068_0045081 3300049584 Bacteria 2656
189 Ga0501071_0504652 3300049587 Bacteria 928
190 Ga0501075_0000809 3300049591 Bacteria 19576
191 Ga0501077_0000043 3300049593 Bacteria 64691
192 Ga0501247_010001 3300049677 Bacteria 1125
193 Ga0501080_0105173 3300049742 Bacteria 2617
194 Ga0501083_0000344 3300049744 Bacteria 29353
195 nmdc:mga05p37_287406_c1 3300050507 Bacteria 1958
196 nmdc:mga05p37_29749_c1 3300050507 Bacteria 6665
197 nmdc:mga09592_7106_c1 3300050508 Bacteria 9098
198 nmdc:mga06r32_101967_c1 3300050510 Bacteria 2817
199 nmdc:mga08y16_229395_c1 3300050511 Bacteria 1920
200 nmdc:mga08y16_766505_c1 3300050511 Bacteria 960
201 nmdc:mga0n895_12769_c1 3300050512 Bacteria 7543
202 nmdc:mga0n895_164291_c1 3300050512 Bacteria 2252
203 nmdc:mga0n895_212647_c1 3300050512 Bacteria 1964
204 nmdc:mga0n895_442703_c1 3300050512 Bacteria 1312
205 nmdc:mga0n895_8173_c1 3300050512 Bacteria 9044
206 nmdc:mga0rr50_203845_c1 3300050513 Bacteria 1627
207 nmdc:mga0rr50_241887_c1 3300050513 Bacteria 1496
208 nmdc:mga0rr50_53918_c1 3300050513 Bacteria 2993
209 nmdc:mga0rr50_540820_c1 3300050513 Bacteria 992
210 nmdc:mga0rr50_6137_c1 3300050513 Bacteria 7273
211 nmdc:mga08x19_179462_c1 3300050514 Bacteria 1445
212 nmdc:mga08x19_36_c1 3300050514 Bacteria 179752
213 nmdc:mga08x19_9021_c1 3300050514 Bacteria 5956
214 nmdc:mga0a205_7338_c1 3300050515 Bacteria 9593
215 Ga0501084_0941878 3300054114 Bacteria 726
216 Ga0501082_0000791 3300060353 Bacteria 27835
217 Ga0530510_0049578 3300061734 Bacteria 3033
218 2836160771 2836160341 Unclassified 5867367
219 Ga0207670_10074492
220 rootH1_10189202
221 Ga0070658_10162216
222 Ga0070676_10236644
223 Ga0070690_100095009
224 Ga0070666_10004150
225 Ga0070682_100487872
226 Ga0070689_100115259
227 Ga0070669_100000067
228 Ga0070669_100185843
229 Ga0070675_100018131
230 Ga0070671_100666869
231 Ga0070674_100963068
232 Ga0070673_100100696
233 Ga0070673_100131510
234 Ga0070673_100383420
235 Ga0070659_100232960
236 Ga0070667_100000989
237 Ga0070709_10000188
238 Ga0070709_10145367
239 Ga0070708_100024531
240 Ga0070678_100051957
241 Ga0068867_100006831
242 Ga0070672_100002838
243 Ga0070686_100114555
244 Ga0070696_100660692
245 Ga0070665_100000192
246 Ga0070665_100014555
247 Ga0070665_100070368
248 Ga0070704_100063118
249 Ga0068855_100014633
250 Ga0070664_100009457
251 Ga0070664_100036194
252 Ga0068857_101139499
253 Ga0068859_100000020
254 Ga0068859_100000645
255 Ga0068859_100015292
256 Ga0068864_100003017
257 Ga0068864_100543677
258 Ga0068866_10019561
259 Ga0068861_100272817
260 Ga0068863_100002762
261 Ga0068863_100016107
262 Ga0068863_100038947
263 Ga0068858_100003319
264 Ga0068860_100001845
265 Ga0068860_100001996
266 Ga0068862_100004331
267 Ga0097621_100019920
268 Ga0097621_100030050
269 Ga0097621_100575118
270 Ga0075428_100038116
271 Ga0075428_100093913
272 Ga0075428_101230205
273 Ga0075431_100001271
274 Ga0075433_10090762
275 Ga0075433_10093767
276 Ga0075434_100014264
277 Ga0075434_100028714
278 Ga0075434_100040842
279 Ga0075434_101282211
280 Ga0075429_100076827
281 Ga0075429_100650053
282 Ga0075436_100000021
283 Ga0075436_100022758
284 Ga0075436_100085569
285 Ga0097620_100000020
286 Ga0097620_100000645
287 Ga0097620_100015292
288 Ga0075435_100010794
289 Ga0075435_100122860
290 Ga0075435_100173895
291 Ga0111539_10995830
292 Ga0105247_10045820
293 Ga0114129_10008054
294 Ga0114129_10896347
295 Ga0105241_10103088
296 Ga0105242_10195809
297 Ga0105248_10224305
298 Ga0105248_10229331
299 Ga0157374_10001464
300 Ga0157378_10014040
301 Ga0157378_11114193
302 Ga0157375_10096029
303 Ga0157375_10326408
304 Ga0163163_10001290
305 Ga0163163_10598341
306 Ga0157380_10656461
307 Ga0157379_10001313
308 Ga0157376_10006691
309 Ga0157376_10012020
310 Ga0157376_10047241
311 Ga0207710_10050475
312 Ga0207680_10005686
313 Ga0207680_10010294
314 Ga0207680_10017504
315 Ga0207699_10000173
316 Ga0207699_10308803
317 Ga0207684_10009437
318 Ga0207684_10076594
319 Ga0207681_10000018
320 Ga0207650_10003732
321 Ga0207650_10330706
322 Ga0207659_10026570
323 Ga0207700_10486679
324 Ga0207644_10066439
325 Ga0207690_10125518
326 Ga0207706_10139915
327 Ga0207686_10487377
328 Ga0207704_10658247
329 Ga0207691_10001818
330 Ga0207711_10000511
331 Ga0207711_10098626
332 Ga0207711_10170428
333 Ga0207689_10183702
334 Ga0207661_10206364
335 Ga0207679_10525178
336 Ga0207651_10015193
337 Ga0207651_10049338
338 Ga0207651_10610490
339 Ga0207658_10005265
340 Ga0207658_10367327
341 Ga0207703_10003939
342 Ga0207678_10056637
343 Ga0207702_10021812
344 Ga0207641_10011680
345 Ga0207641_10064569
346 Ga0207641_10241156
347 Ga0207648_10010594
348 Ga0207648_10414574
349 Ga0207676_10018259
350 Ga0207675_100417898
351 Ga0207683_10003642
352 Ga0207683_11238683
353 Ga0209998_10021273
354 Ga0268266_10000298
355 Ga0268266_10002472
356 Ga0268266_10035592
357 Ga0268265_10013859
358 Ga0268264_10001393
359 Ga0268264_10003718
360 Ga0265332_10059224
361 Ga0265329_10026877
362 Ga0265316_10024599
363 Ga0307508_10004892
364 Ga0265314_10228604
365 Ga0307406_10000072
366 Ga0307414_10160308
367 Ga0373929_0000012
368 Ga0373961_0000515
369 Ga0373935_0022766
370 Ga0373925_0931858
371 Ga0436365_0787433
372 Ga0451795_0212239
373 Ga0451798_1068075
374 Ga0451807_0920738
375 Ga0451833_0522025
376 Ga0451845_0301766
377 Ga0451849_0480959
378 Ga0451577_0189102
379 Ga0466963_0323102
380 Ga0453684_0048218
381 Ga0453684_0065294
382 Ga0453684_0869850
383 Ga0495629_0131960
384 Ga0495580_0193075
385 Ga0495582_0039033
386 Ga0495585_0018059
387 Ga0495594_0357674
388 Ga0495647_0084492
389 Ga0495658_0004839
390 Ga0495613_0270686
391 Ga0496100_0152131
392 Ga0496101_0100132
393 Ga0496102_0002697
394 Ga0496105_0152676
395 Ga0496106_0000977
396 Ga0496107_0005498
397 Ga0496108_0038168
398 Ga0496109_0140240
399 Ga0496110_0041896
400 Ga0496111_0137564
401 Ga0496113_0065710
402 Ga0496114_0000028
403 Ga0501034_0013680
404 Ga0501034_0191190
405 Ga0501067_0043692
406 Ga0501068_0045081
407 Ga0501071_0504652
408 Ga0501075_0000809
409 Ga0501077_0000043
410 Ga0501247_010001
411 Ga0501080_0105173
412 Ga0501083_0000344
413 nmdc:mga05p37_287406_c1
414 nmdc:mga05p37_29749_c1
415 nmdc:mga09592_7106_c1
416 nmdc:mga06r32_101967_c1
417 nmdc:mga08y16_229395_c1
418 nmdc:mga08y16_766505_c1
419 nmdc:mga0n895_12769_c1
420 nmdc:mga0n895_164291_c1
421 nmdc:mga0n895_212647_c1
422 nmdc:mga0n895_442703_c1
423 nmdc:mga0n895_8173_c1
424 nmdc:mga0rr50_203845_c1
425 nmdc:mga0rr50_241887_c1
426 nmdc:mga0rr50_53918_c1
427 nmdc:mga0rr50_540820_c1
428 nmdc:mga0rr50_6137_c1
429 nmdc:mga08x19_179462_c1
430 nmdc:mga08x19_36_c1
431 nmdc:mga08x19_9021_c1
432 nmdc:mga0a205_7338_c1
433 Ga0501084_0941878
434 Ga0501082_0000791
435 Ga0530510_0049578
436 2836160771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

55

232

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ala-assembly1.cif.gz_B-2 human gch-gfrp inhibitory complex 0.9523 23 200
6z85-assembly1.cif.gz_A inhibitory human gtp cyclohydrolase i - gfrp complex 0.9506 22 200
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.948 72 200
6z88-assembly1.cif.gz_G human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9444 17 200
6z88-assembly1.cif.gz_J human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9438 18 200
ID Description Score Start End Superfamily
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9651 81 200 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9554 72 199 3.30.1130.10
1wm9E01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9536 21 63 1.10.286.10
1wm9B01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.953 22 63 1.10.286.10
1wm9A01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9506 22 63 1.10.286.10
ID Description Score Start End GO Terms
AF-X1MIN2-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9843 74 166 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A6B3N329-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9708 82 203 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A6B0XHF6-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) 0.97 20 201 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A0G4MU50-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9686 84 200 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
GO:0046656
AF-A0A538BY74-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9683 94 203 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654

Map