F330005

General Info

Members Datasets Scaffolds Average Seq Length
218 147 436 144

Family's Representative Sequence

Representative Sequence 3300025291|Ga0209675_1010033|Ga0209675_10100333
Length 176
Sequence MAGPGDPKAVTLRHGWHEQEDESNLLHTTGATIQPMTRFSLAQTPIDTATLRAQLLDDRVGGYASFEGWVRNHNDGRDVLGLRYEAYASLAEAEGEKVLDEACAKFDILDVRCVHRVGDLVIGEMAVWVGVSAAHRDAAFAACRYVIDEVKARVPIWKHERYAEGDAGWLHPDTTP

Samples

Sample ID Description Type Environment
1 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
102 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
106 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
107 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
108 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
113 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
120 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
121 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
122 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
123 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
147 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.94
Nodule 0
Rhizoplane 4.59
Rhizosphere 65.6
Stem 0
Stem Tuber 0
Unclassified 1.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209675_1010033 3300025291 Bacteria 3276
2 SwRhRL2b_contig_3015742 2162886007 Bacteria 4660
3 JGI25151J46595_10000818 3300003187 Bacteria 24780
4 JGI25151J46595_10018579 3300003187 Bacteria 2979
5 JGI25151J46595_10092145 3300003187 Bacteria 840
6 JGI25153J46596_10122810 3300003215 Bacteria 583
7 Ga0055526_1009709 3300003771 Bacteria 4586
8 Ga0055524_1008824 3300003775 Bacteria 4153
9 Ga0055524_1011066 3300003775 Bacteria 3548
10 Ga0055524_1014164 3300003775 Bacteria 2970
11 Ga0055536_1015529 3300003781 Bacteria 2599
12 Ga0055536_1042952 3300003781 Bacteria 1053
13 Ga0055534_1039990 3300003784 Bacteria 693
14 Ga0055530_10003516 3300003791 Bacteria 8853
15 Ga0055531_10014683 3300003794 Bacteria 3509
16 Ga0055531_10046999 3300003794 Bacteria 1180
17 Ga0065704_10071655 3300005289 Bacteria 10362
18 Ga0065715_10178152 3300005293 Bacteria 1483
19 Ga0070658_10779012 3300005327 Bacteria 831
20 Ga0070680_100235574 3300005336 Bacteria 1546
21 Ga0070682_100377064 3300005337 Bacteria 1066
22 Ga0068868_101773865 3300005338 Bacteria 583
23 Ga0068868_101977784 3300005338 Bacteria 553
24 Ga0070691_10199644 3300005341 Bacteria 1050
25 Ga0070669_100022660 3300005353 Bacteria 4491
26 Ga0070669_100377759 3300005353 Bacteria 1155
27 Ga0070675_100601173 3300005354 Bacteria 997
28 Ga0070671_100127239 3300005355 Bacteria 2145
29 Ga0070673_101783412 3300005364 Bacteria 583
30 Ga0070667_100410824 3300005367 Bacteria 1233
31 Ga0070678_100142896 3300005456 Bacteria 1917
32 Ga0070681_10569447 3300005458 Bacteria 1046
33 Ga0070681_11278807 3300005458 Bacteria 656
34 Ga0068867_100589811 3300005459 Bacteria 968
35 Ga0070679_101351220 3300005530 Bacteria 658
36 Ga0068853_100830748 3300005539 Bacteria 885
37 Ga0070672_100017520 3300005543 Bacteria 5159
38 Ga0070696_100112148 3300005546 Bacteria 1965
39 Ga0070693_100007564 3300005547 Bacteria 5316
40 Ga0068855_100702714 3300005563 Bacteria 1082
41 Ga0068852_100000955 3300005616 Bacteria 19038
42 Ga0068863_100317285 3300005841 Bacteria 1513
43 Ga0068863_101700884 3300005841 Bacteria 640
44 Ga0068863_101976228 3300005841 Bacteria 593
45 Ga0070717_10515082 3300006028 Bacteria 1082
46 Ga0075364_10057092 3300006051 Bacteria 2556
47 Ga0075364_10350399 3300006051 Bacteria 1006
48 Ga0097621_100277913 3300006237 Bacteria 1473
49 Ga0097621_101392345 3300006237 Bacteria 664
50 Ga0068871_100259493 3300006358 Bacteria 1515
51 Ga0068871_100866958 3300006358 Bacteria 835
52 Ga0075431_100967534 3300006847 Bacteria 819
53 Ga0068865_101189139 3300006881 Bacteria 674
54 Ga0105240_10562898 3300009093 Bacteria 1260
55 Ga0105243_10892487 3300009148 Bacteria 884
56 Ga0105242_10452886 3300009176 Bacteria 1210
57 Ga0105242_11281798 3300009176 Bacteria 756
58 Ga0105248_10302937 3300009177 Bacteria 1800
59 Ga0105248_10600831 3300009177 Bacteria 1241
60 Ga0105238_10590359 3300009551 Bacteria 1118
61 Ga0105032_100170 3300009979 Bacteria 6762
62 Ga0105239_11183415 3300010375 Bacteria 881
63 Ga0157373_10761313 3300013100 Bacteria 712
64 Ga0157370_10812103 3300013104 Bacteria 851
65 Ga0157374_10942266 3300013296 Bacteria 882
66 Ga0157378_10000552 3300013297 Bacteria 35579
67 Ga0163162_10292881 3300013306 Bacteria 1759
68 Ga0163162_10581566 3300013306 Bacteria 1247
69 Ga0163162_10906421 3300013306 Bacteria 994
70 Ga0163162_11483635 3300013306 Bacteria 772
71 Ga0157372_10324068 3300013307 Bacteria 1794
72 Ga0157372_11929957 3300013307 Bacteria 679
73 Ga0157375_10031195 3300013308 Bacteria 5033
74 Ga0157375_10099958 3300013308 Bacteria 2980
75 Ga0157375_10430116 3300013308 Bacteria 1486
76 Ga0163163_10079551 3300014325 Bacteria 3276
77 Ga0157380_10305645 3300014326 Bacteria 1467
78 Ga0157380_10342621 3300014326 Bacteria 1395
79 Ga0157380_11519835 3300014326 Bacteria 723
80 Ga0157379_10000143 3300014968 Bacteria 51687
81 Ga0157379_10407118 3300014968 Bacteria 1251
82 Ga0157376_10724657 3300014969 Bacteria 1002
83 Ga0163161_10767872 3300017792 Bacteria 808
84 Ga0207425_1001833 3300025245 Bacteria 8221
85 Ga0209673_1041574 3300025273 Bacteria 1303
86 Ga0209676_1007525 3300025292 Bacteria 5083
87 Ga0209676_1007836 3300025292 Bacteria 4912
88 Ga0209676_1007864 3300025292 Bacteria 4898
89 Ga0209676_1018672 3300025292 Bacteria 2411
90 Ga0209676_1026770 3300025292 Bacteria 1825
91 Ga0209025_1000884 3300025294 Bacteria 46917
92 Ga0209025_1003704 3300025294 Bacteria 14045
93 Ga0209025_1030651 3300025294 Bacteria 2568
94 Ga0209025_1032876 3300025294 Bacteria 2413
95 Ga0209564_1007666 3300025295 Bacteria 5512
96 Ga0209564_1022122 3300025295 Bacteria 2258
97 Ga0209758_1007260 3300025297 Bacteria 7614
98 Ga0209758_1028021 3300025297 Bacteria 2394
99 Ga0209758_1031266 3300025297 Bacteria 2187
100 Ga0209050_1001755 3300025298 Bacteria 21513
101 Ga0209256_1003855 3300025299 Bacteria 9996
102 Ga0209256_1004843 3300025299 Bacteria 8141
103 Ga0209256_1007593 3300025299 Bacteria 5295
104 Ga0207426_1046584 3300025302 Bacteria 1312
105 Ga0209051_1013668 3300025303 Bacteria 3845
106 Ga0209257_1000133 3300025304 Bacteria 208808
107 Ga0209257_1000320 3300025304 Bacteria 100514
108 Ga0209257_1002186 3300025304 Bacteria 20241
109 Ga0209257_1002276 3300025304 Bacteria 19574
110 Ga0209257_1002557 3300025304 Bacteria 17736
111 Ga0207707_10350453 3300025912 Bacteria 1272
112 Ga0207707_10640949 3300025912 Bacteria 896
113 Ga0207695_10020391 3300025913 Bacteria 7594
114 Ga0207695_10434510 3300025913 Bacteria 1196
115 Ga0207660_10280229 3300025917 Bacteria 1323
116 Ga0207681_10025647 3300025923 Bacteria 3794
117 Ga0207681_10447858 3300025923 Bacteria 1050
118 Ga0207650_10472553 3300025925 Bacteria 1045
119 Ga0207650_10496616 3300025925 Bacteria 1019
120 Ga0207650_11157435 3300025925 Bacteria 658
121 Ga0207659_10477158 3300025926 Bacteria 1053
122 Ga0207644_10012209 3300025931 Bacteria 5700
123 Ga0207644_10097777 3300025931 Bacteria 2199
124 Ga0207691_10022309 3300025940 Bacteria 5971
125 Ga0207711_10316053 3300025941 Bacteria 1442
126 Ga0207689_10551586 3300025942 Bacteria 968
127 Ga0207668_10133772 3300025972 Bacteria 1897
128 Ga0207668_10150940 3300025972 Bacteria 1799
129 Ga0207640_12016378 3300025981 Bacteria 523
130 Ga0207703_11877894 3300026035 Unclassified 575
131 Ga0207639_10410673 3300026041 Bacteria 1222
132 Ga0207639_10918008 3300026041 Bacteria 819
133 Ga0207702_10620137 3300026078 Bacteria 1062
134 Ga0207641_10228012 3300026088 Bacteria 1730
135 Ga0207641_10599500 3300026088 Bacteria 1078
136 Ga0207641_11573585 3300026088 Bacteria 659
137 Ga0207683_10026445 3300026121 Bacteria 5007
138 Ga0207683_10401395 3300026121 Bacteria 1261
139 Ga0207683_11542726 3300026121 Bacteria 613
140 Ga0207698_10001216 3300026142 Bacteria 15039
141 Ga0209984_1032849 3300027424 Bacteria 736
142 Ga0209999_1000714 3300027543 Bacteria 5385
143 Ga0209983_1000296 3300027665 Bacteria 10384
144 Ga0209971_1013235 3300027682 Bacteria 1955
145 Ga0209974_10008039 3300027876 Bacteria 3614
146 Ga0307513_10223785 3300031456 Bacteria 1700
147 Ga0307408_100146963 3300031548 Bacteria 1857
148 Ga0307405_11387658 3300031731 Bacteria 614
149 Ga0307413_10022156 3300031824 Bacteria 3418
150 Ga0307416_100314899 3300032002 Bacteria 1564
151 Ga0307414_10174378 3300032004 Bacteria 1723
152 Ga0307414_10240800 3300032004 Bacteria 1497
153 Ga0373946_0283729 3300035171 Bacteria 815
154 Ga0395905_0133704 3300037471 Bacteria 2333
155 Ga0439436_0017992 3300041404 Bacteria 2114
156 Ga0439436_0070723 3300041404 Bacteria 972
157 Ga0439447_011791 3300041407 Bacteria 2533
158 Ga0439465_0002703 3300041413 Bacteria 5800
159 Ga0439465_0023009 3300041413 Bacteria 1959
160 Ga0439465_0309251 3300041413 Bacteria 592
161 Ga0451793_0256608 3300041452 Bacteria 676
162 Ga0451797_0856473 3300041453 Bacteria 722
163 Ga0451797_1478942 3300041453 Bacteria 967
164 Ga0451798_0514276 3300041458 Bacteria 1190
165 Ga0451800_0255242 3300041459 Bacteria 653
166 Ga0451802_1797360 3300041460 Bacteria 647
167 Ga0451807_0897686 3300041486 Bacteria 1243
168 Ga0451837_0374541 3300041494 Bacteria 981
169 Ga0451837_0940577 3300041494 Bacteria 1100
170 Ga0451841_0433661 3300041498 Bacteria 1527
171 Ga0451849_0435274 3300041505 Unclassified 1262
172 Ga0451843_0470605 3300041509 Bacteria 995
173 Ga0451843_0569891 3300041509 Bacteria 3459
174 Ga0451843_1262928 3300041509 Bacteria 804
175 Ga0451853_0467511 3300041512 Unclassified 1181
176 Ga0451853_1712496 3300041512 Bacteria 640
177 Ga0439431_0095645 3300041997 Bacteria 813
178 Ga0439445_0140113 3300042004 Bacteria 701
179 Ga0439432_007569 3300042006 Bacteria 3844
180 Ga0439449_0002715 3300042007 Bacteria 6889
181 Ga0439449_0010020 3300042007 Bacteria 3585
182 Ga0439449_0048885 3300042007 Bacteria 1565
183 Ga0439452_014780 3300042010 Bacteria 2159
184 Ga0439457_041045 3300042014 Bacteria 1031
185 Ga0439462_0011670 3300042015 Bacteria 2241
186 Ga0439462_0016365 3300042015 Bacteria 1915
187 Ga0450898_129650 3300042134 Bacteria 542
188 Ga0450906_110933 3300042145 Bacteria 503
189 Ga0451577_0007992 3300042876 Bacteria 10329
190 Ga0495651_0346960 3300046462 Bacteria 982
191 Ga0495663_0074759 3300046525 Bacteria 1083
192 Ga0495656_0000843 3300046615 Bacteria 9891
193 Ga0495656_0049744 3300046615 Bacteria 1786
194 Ga0495668_0002920 3300046616 Bacteria 13484
195 Ga0495659_0266864 3300046664 Bacteria 716
196 Ga0495670_0093044 3300046691 Bacteria 1545
197 Ga0495670_0206030 3300046691 Bacteria 1042
198 Ga0495636_0003708 3300047318 Bacteria 5942
199 Ga0496100_1019440 3300048903 Bacteria 651
200 Ga0496101_0744738 3300048904 Bacteria 773
201 Ga0496108_0013046 3300048911 Bacteria 6772
202 Ga0496121_0009916 3300048924 Bacteria 10842
203 Ga0496122_0014313 3300048925 Bacteria 7680
204 Ga0496123_0012068 3300048926 Bacteria 7410
205 Ga0496124_0041030 3300048927 Bacteria 3998
206 Ga0501034_0517854 3300049571 Bacteria 1105
207 Ga0501042_0968527 3300049578 Bacteria 620
208 Ga0501043_0001953 3300049579 Bacteria 17638
209 nmdc:mga00v17_230224_c1 3300050491 Bacteria 1201
210 nmdc:mga00v17_248665_c1 3300050491 Bacteria 1153
211 nmdc:mga00v17_294961_c1 3300050491 Bacteria 1053
212 nmdc:mga00v17_3159_c1 3300050491 Bacteria 8486
213 nmdc:mga00v17_413950_c1 3300050491 Bacteria 876
214 nmdc:mga0yw44_583101_c1 3300050492 Bacteria 759
215 nmdc:mga06r32_939951_c1 3300050510 Bacteria 819
216 Ga0495619_0684294 3300053085 Bacteria 698
217 2941493402 2941489479 Bacteria 6313767
218 2995952501 2995948881 Bacteria 6358104
219 Ga0209675_1010033
220 SwRhRL2b_contig_3015742
221 JGI25151J46595_10000818
222 JGI25151J46595_10018579
223 JGI25151J46595_10092145
224 JGI25153J46596_10122810
225 Ga0055526_1009709
226 Ga0055524_1008824
227 Ga0055524_1011066
228 Ga0055524_1014164
229 Ga0055536_1015529
230 Ga0055536_1042952
231 Ga0055534_1039990
232 Ga0055530_10003516
233 Ga0055531_10014683
234 Ga0055531_10046999
235 Ga0065704_10071655
236 Ga0065715_10178152
237 Ga0070658_10779012
238 Ga0070680_100235574
239 Ga0070682_100377064
240 Ga0068868_101773865
241 Ga0068868_101977784
242 Ga0070691_10199644
243 Ga0070669_100022660
244 Ga0070669_100377759
245 Ga0070675_100601173
246 Ga0070671_100127239
247 Ga0070673_101783412
248 Ga0070667_100410824
249 Ga0070678_100142896
250 Ga0070681_10569447
251 Ga0070681_11278807
252 Ga0068867_100589811
253 Ga0070679_101351220
254 Ga0068853_100830748
255 Ga0070672_100017520
256 Ga0070696_100112148
257 Ga0070693_100007564
258 Ga0068855_100702714
259 Ga0068852_100000955
260 Ga0068863_100317285
261 Ga0068863_101700884
262 Ga0068863_101976228
263 Ga0070717_10515082
264 Ga0075364_10057092
265 Ga0075364_10350399
266 Ga0097621_100277913
267 Ga0097621_101392345
268 Ga0068871_100259493
269 Ga0068871_100866958
270 Ga0075431_100967534
271 Ga0068865_101189139
272 Ga0105240_10562898
273 Ga0105243_10892487
274 Ga0105242_10452886
275 Ga0105242_11281798
276 Ga0105248_10302937
277 Ga0105248_10600831
278 Ga0105238_10590359
279 Ga0105032_100170
280 Ga0105239_11183415
281 Ga0157373_10761313
282 Ga0157370_10812103
283 Ga0157374_10942266
284 Ga0157378_10000552
285 Ga0163162_10292881
286 Ga0163162_10581566
287 Ga0163162_10906421
288 Ga0163162_11483635
289 Ga0157372_10324068
290 Ga0157372_11929957
291 Ga0157375_10031195
292 Ga0157375_10099958
293 Ga0157375_10430116
294 Ga0163163_10079551
295 Ga0157380_10305645
296 Ga0157380_10342621
297 Ga0157380_11519835
298 Ga0157379_10000143
299 Ga0157379_10407118
300 Ga0157376_10724657
301 Ga0163161_10767872
302 Ga0207425_1001833
303 Ga0209673_1041574
304 Ga0209676_1007525
305 Ga0209676_1007836
306 Ga0209676_1007864
307 Ga0209676_1018672
308 Ga0209676_1026770
309 Ga0209025_1000884
310 Ga0209025_1003704
311 Ga0209025_1030651
312 Ga0209025_1032876
313 Ga0209564_1007666
314 Ga0209564_1022122
315 Ga0209758_1007260
316 Ga0209758_1028021
317 Ga0209758_1031266
318 Ga0209050_1001755
319 Ga0209256_1003855
320 Ga0209256_1004843
321 Ga0209256_1007593
322 Ga0207426_1046584
323 Ga0209051_1013668
324 Ga0209257_1000133
325 Ga0209257_1000320
326 Ga0209257_1002186
327 Ga0209257_1002276
328 Ga0209257_1002557
329 Ga0207707_10350453
330 Ga0207707_10640949
331 Ga0207695_10020391
332 Ga0207695_10434510
333 Ga0207660_10280229
334 Ga0207681_10025647
335 Ga0207681_10447858
336 Ga0207650_10472553
337 Ga0207650_10496616
338 Ga0207650_11157435
339 Ga0207659_10477158
340 Ga0207644_10012209
341 Ga0207644_10097777
342 Ga0207691_10022309
343 Ga0207711_10316053
344 Ga0207689_10551586
345 Ga0207668_10133772
346 Ga0207668_10150940
347 Ga0207640_12016378
348 Ga0207703_11877894
349 Ga0207639_10410673
350 Ga0207639_10918008
351 Ga0207702_10620137
352 Ga0207641_10228012
353 Ga0207641_10599500
354 Ga0207641_11573585
355 Ga0207683_10026445
356 Ga0207683_10401395
357 Ga0207683_11542726
358 Ga0207698_10001216
359 Ga0209984_1032849
360 Ga0209999_1000714
361 Ga0209983_1000296
362 Ga0209971_1013235
363 Ga0209974_10008039
364 Ga0307513_10223785
365 Ga0307408_100146963
366 Ga0307405_11387658
367 Ga0307413_10022156
368 Ga0307416_100314899
369 Ga0307414_10174378
370 Ga0307414_10240800
371 Ga0373946_0283729
372 Ga0395905_0133704
373 Ga0439436_0017992
374 Ga0439436_0070723
375 Ga0439447_011791
376 Ga0439465_0002703
377 Ga0439465_0023009
378 Ga0439465_0309251
379 Ga0451793_0256608
380 Ga0451797_0856473
381 Ga0451797_1478942
382 Ga0451798_0514276
383 Ga0451800_0255242
384 Ga0451802_1797360
385 Ga0451807_0897686
386 Ga0451837_0374541
387 Ga0451837_0940577
388 Ga0451841_0433661
389 Ga0451849_0435274
390 Ga0451843_0470605
391 Ga0451843_0569891
392 Ga0451843_1262928
393 Ga0451853_0467511
394 Ga0451853_1712496
395 Ga0439431_0095645
396 Ga0439445_0140113
397 Ga0439432_007569
398 Ga0439449_0002715
399 Ga0439449_0010020
400 Ga0439449_0048885
401 Ga0439452_014780
402 Ga0439457_041045
403 Ga0439462_0011670
404 Ga0439462_0016365
405 Ga0450898_129650
406 Ga0450906_110933
407 Ga0451577_0007992
408 Ga0495651_0346960
409 Ga0495663_0074759
410 Ga0495656_0000843
411 Ga0495656_0049744
412 Ga0495668_0002920
413 Ga0495659_0266864
414 Ga0495670_0093044
415 Ga0495670_0206030
416 Ga0495636_0003708
417 Ga0496100_1019440
418 Ga0496101_0744738
419 Ga0496108_0013046
420 Ga0496121_0009916
421 Ga0496122_0014313
422 Ga0496123_0012068
423 Ga0496124_0041030
424 Ga0501034_0517854
425 Ga0501042_0968527
426 Ga0501043_0001953
427 nmdc:mga00v17_230224_c1
428 nmdc:mga00v17_248665_c1
429 nmdc:mga00v17_294961_c1
430 nmdc:mga00v17_3159_c1
431 nmdc:mga00v17_413950_c1
432 nmdc:mga0yw44_583101_c1
433 nmdc:mga06r32_939951_c1
434 Ga0495619_0684294
435 2941493402
436 2995952501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

41

153

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9681 4 128
2wp4-assembly1.cif.gz_A crystal structure of rv3119 from mycobacterium tuberculosis 0.9588 5 125
8hlg-assembly1.cif.gz_B crystal structure of moae 0.9559 4 135
6jc0-assembly1.cif.gz_B structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9538 4 135
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.9446 4 124
ID Description Score Start End Superfamily
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9706 4 128 3.90.1170.40
af_P91500_195_340_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9665 4 140 3.90.1170.40
af_Q86HF4_1_145_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9651 4 135 3.90.1170.40
af_Q6AY59_40_191_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9646 4 136 3.90.1170.40
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9362 2 136 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A355S624-F1-model_v4 Molybdopterin-converting factor chain 2 0.9962 4 114 GO:0006777
AF-A0A661FSA4-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9906 5 135 GO:0006777
GO:0030366
AF-A0A0Q8DDR1-F1-model_v4 Molybdopterin biosynthesis protein MoeE 0.9876 4 135 GO:0006777
AF-E4NGQ4-F1-model_v4 Putative molybdenum cofactor biosynthesis protein E 0.9876 4 135 GO:0006777
AF-A0A7J4PD46-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.9874 24 116 GO:0006777

Map