F329972

General Info

Members Datasets Scaffolds Average Seq Length
218 158 436 185

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10254232|Ga0163163_102542322
Length 205
Sequence VVTMAPNPGRGTIAVPVAKLIYSTLASLDGYTKDEDGRFDWAKPDEEVHSFFNDLERPVGTHLYGRRMYETMVYWEGPEAMEGQPPFIRDFAEIWRAAEKVVYSRTLEAPSSARTRIERSFDPEAVRRMKDEAERDLAIGGPELAALAFEAGLVDEVHLCLVPVAVGGGTPALPAGRRVDLELLDERRFSNGTVYLRHRLDLPER

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 8.72
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10254232 3300014325 Bacteria 1808
2 Ga0070683_101173701 3300005329 Bacteria 738
3 Ga0070680_100016366 3300005336 Bacteria 5835
4 Ga0070660_100090667 3300005339 Bacteria 2410
5 Ga0070691_10426327 3300005341 Bacteria 753
6 Ga0070661_100038581 3300005344 Bacteria 3478
7 Ga0070692_10112598 3300005345 Bacteria 1507
8 Ga0070669_100258545 3300005353 Bacteria 1389
9 Ga0070671_100662260 3300005355 Bacteria 904
10 Ga0070673_101528024 3300005364 Bacteria 630
11 Ga0070659_100001945 3300005366 Bacteria 14757
12 Ga0070659_100162519 3300005366 Bacteria 1826
13 Ga0070709_10205655 3300005434 Bacteria 1397
14 Ga0070713_100265936 3300005436 Bacteria 1569
15 Ga0070710_10048557 3300005437 Bacteria 2371
16 Ga0070701_10024013 3300005438 Bacteria 2944
17 Ga0070708_100786339 3300005445 Bacteria 895
18 Ga0070678_100179052 3300005456 Bacteria 1734
19 Ga0070681_10032229 3300005458 Bacteria 5259
20 Ga0068867_100053591 3300005459 Bacteria 2979
21 Ga0070685_10349752 3300005466 Bacteria 1010
22 Ga0070707_100356056 3300005468 Bacteria 1422
23 Ga0070707_100406865 3300005468 Bacteria 1321
24 Ga0070698_100919682 3300005471 Bacteria 821
25 Ga0070679_100628734 3300005530 Bacteria 1017
26 Ga0070684_100035019 3300005535 Bacteria 4295
27 Ga0070684_100738065 3300005535 Bacteria 919
28 Ga0068853_100261000 3300005539 Bacteria 1593
29 Ga0068853_100595146 3300005539 Bacteria 1050
30 Ga0070696_100338308 3300005546 Bacteria 1163
31 Ga0070704_100184036 3300005549 Bacteria 1673
32 Ga0070664_100041201 3300005564 Bacteria 3896
33 Ga0070664_100089467 3300005564 Bacteria 2664
34 Ga0068857_100083185 3300005577 Bacteria 2859
35 Ga0068854_100021954 3300005578 Bacteria 4340
36 Ga0068856_100017141 3300005614 Bacteria 7021
37 Ga0070702_100116058 3300005615 Bacteria 1668
38 Ga0068852_100003560 3300005616 Bacteria 10902
39 Ga0068864_100001227 3300005618 Bacteria 21309
40 Ga0068864_100912231 3300005618 Unclassified 868
41 Ga0068866_10614435 3300005718 Bacteria 736
42 Ga0068861_101066708 3300005719 Bacteria 775
43 Ga0068863_100010885 3300005841 Bacteria 8820
44 Ga0068860_100928905 3300005843 Bacteria 887
45 Ga0081455_10230901 3300005937 Bacteria 1366
46 Ga0081540_1000958 3300005983 Bacteria 26037
47 Ga0081539_10014111 3300005985 Bacteria 5940
48 Ga0075428_100038291 3300006844 Bacteria 5276
49 Ga0075428_100291125 3300006844 Bacteria 1756
50 Ga0075428_100442113 3300006844 Bacteria 1393
51 Ga0075430_100050525 3300006846 Bacteria 3506
52 Ga0075430_100089734 3300006846 Bacteria 2571
53 Ga0075431_100029010 3300006847 Bacteria 5691
54 Ga0075431_100271661 3300006847 Bacteria 1718
55 Ga0075429_100093798 3300006880 Bacteria 2618
56 Ga0075436_100259482 3300006914 Bacteria 1239
57 Ga0105240_10116787 3300009093 Bacteria 3218
58 Ga0105245_10525900 3300009098 Bacteria 1202
59 Ga0105245_10623051 3300009098 Bacteria 1107
60 Ga0105247_10297358 3300009101 Bacteria 1119
61 Ga0114129_10733771 3300009147 Bacteria 1266
62 Ga0114129_11210513 3300009147 Unclassified 940
63 Ga0105242_10174388 3300009176 Bacteria 1892
64 Ga0105248_10035489 3300009177 Bacteria 5578
65 Ga0105237_10164349 3300009545 Bacteria 2218
66 Ga0105238_10020434 3300009551 Bacteria 6741
67 Ga0105239_10090942 3300010375 Bacteria 3367
68 Ga0105246_10313750 3300011119 Bacteria 1271
69 Ga0157370_10008970 3300013104 Bacteria 10735
70 Ga0157369_10014358 3300013105 Bacteria 8943
71 Ga0157374_10047709 3300013296 Bacteria 3972
72 Ga0163162_10158765 3300013306 Bacteria 2382
73 Ga0157372_10086822 3300013307 Bacteria 3549
74 Ga0157375_10001210 3300013308 Bacteria 22261
75 Ga0157375_10052822 3300013308 Bacteria 3997
76 Ga0163163_10120361 3300014325 Bacteria 2659
77 Ga0157376_10318509 3300014969 Bacteria 1478
78 Ga0157376_10438128 3300014969 Bacteria 1272
79 Ga0206354_10339989 3300020081 Bacteria 3060
80 Ga0206353_10394525 3300020082 Bacteria 1864
81 Ga0224712_10081306 3300022467 Bacteria 1338
82 Ga0207699_10105355 3300025906 Bacteria 1798
83 Ga0207699_10184029 3300025906 Bacteria 1406
84 Ga0207695_10139823 3300025913 Bacteria 2371
85 Ga0207693_10041184 3300025915 Bacteria 3636
86 Ga0207663_10232035 3300025916 Bacteria 1349
87 Ga0207660_10008676 3300025917 Bacteria 6574
88 Ga0207657_10044288 3300025919 Bacteria 3913
89 Ga0207657_10148817 3300025919 Bacteria 1908
90 Ga0207649_10025308 3300025920 Bacteria 3459
91 Ga0207652_10072724 3300025921 Bacteria 2990
92 Ga0207646_10146368 3300025922 Bacteria 2129
93 Ga0207646_10867031 3300025922 Bacteria 802
94 Ga0207700_10262499 3300025928 Bacteria 1479
95 Ga0207644_10602614 3300025931 Bacteria 912
96 Ga0207690_10028787 3300025932 Bacteria 3524
97 Ga0207669_10087537 3300025937 Bacteria 2018
98 Ga0207711_10104438 3300025941 Bacteria 2511
99 Ga0207661_10001895 3300025944 Bacteria 14343
100 Ga0207661_10578606 3300025944 Bacteria 1030
101 Ga0207661_11008127 3300025944 Bacteria 767
102 Ga0207679_10011546 3300025945 Bacteria 5727
103 Ga0207679_10025494 3300025945 Bacteria 4068
104 Ga0207679_10090001 3300025945 Bacteria 2371
105 Ga0207639_10146949 3300026041 Bacteria 1970
106 Ga0207639_10277886 3300026041 Bacteria 1472
107 Ga0207702_10250051 3300026078 Bacteria 1664
108 Ga0207648_10005701 3300026089 Bacteria 12488
109 Ga0207676_10540933 3300026095 Bacteria 1111
110 Ga0207674_10283848 3300026116 Bacteria 1604
111 Ga0207674_10891032 3300026116 Bacteria 858
112 Ga0207675_100175440 3300026118 Bacteria 2050
113 Ga0207698_10330275 3300026142 Bacteria 1432
114 Ga0265318_10010263 3300028577 Bacteria 4088
115 Ga0265324_10055739 3300029957 Bacteria 1355
116 Ga0265328_10042357 3300031239 Bacteria 1676
117 Ga0265320_10067311 3300031240 Bacteria 1695
118 Ga0265340_10008699 3300031247 Bacteria 5476
119 Ga0265340_10061871 3300031247 Bacteria 1789
120 Ga0265316_10032430 3300031344 Bacteria 4263
121 Ga0307406_10103562 3300031901 Bacteria 1944
122 Ga0307415_100333175 3300032126 Bacteria 1271
123 Ga0373949_0000002 3300035090 Bacteria 102187
124 Ga0373947_0584293 3300035725 Bacteria 761
125 Ga0395899_0019038 3300037312 Bacteria 5217
126 Ga0395899_0021620 3300037312 Bacteria 4879
127 Ga0395899_0057233 3300037312 Bacteria 2879
128 Ga0395900_0019916 3300037418 Bacteria 6839
129 Ga0395900_0523324 3300037418 Bacteria 1133
130 Ga0395900_0562316 3300037418 Bacteria 1084
131 Ga0395898_0011129 3300037466 Bacteria 9367
132 Ga0395898_0018430 3300037466 Bacteria 7118
133 Ga0395898_0035903 3300037466 Bacteria 4925
134 Ga0395898_0071238 3300037466 Bacteria 3359
135 Ga0395898_0440921 3300037466 Bacteria 1240
136 Ga0395898_0490935 3300037466 Bacteria 1168
137 Ga0395905_0010592 3300037471 Bacteria 8953
138 Ga0395905_0013096 3300037471 Bacteria 7962
139 Ga0395905_0035645 3300037471 Bacteria 4671
140 Ga0395905_0059739 3300037471 Bacteria 3564
141 Ga0395905_0061686 3300037471 Bacteria 3507
142 Ga0395905_0786435 3300037471 Bacteria 854
143 Ga0395901_0004228 3300038443 Bacteria 14476
144 Ga0395901_0005173 3300038443 Bacteria 13163
145 Ga0395901_0007676 3300038443 Bacteria 10880
146 Ga0395901_0017945 3300038443 Bacteria 7223
147 Ga0395901_0039877 3300038443 Bacteria 4861
148 Ga0395901_0101028 3300038443 Bacteria 3026
149 Ga0395901_0196633 3300038443 Bacteria 2114
150 Ga0395901_0303072 3300038443 Bacteria 1656
151 Ga0395901_0390526 3300038443 Bacteria 1431
152 Ga0466965_0000009 3300044683 Bacteria 122488
153 Ga0466966_0105576 3300044684 Bacteria 1739
154 Ga0466963_0471298 3300044694 Bacteria 886
155 Ga0466967_0084716 3300045976 Bacteria 2868
156 Ga0495592_0186642 3300046454 Bacteria 1408
157 Ga0495629_0240822 3300046459 Bacteria 1246
158 Ga0495641_0112206 3300046461 Bacteria 1216
159 Ga0495582_0077229 3300046473 Bacteria 1847
160 Ga0495639_0022324 3300046475 Bacteria 2775
161 Ga0495662_0065327 3300046476 Bacteria 1759
162 Ga0495608_0040629 3300046511 Bacteria 3116
163 Ga0495628_0159914 3300046516 Bacteria 1712
164 Ga0495630_0004309 3300046517 Bacteria 9984
165 Ga0495652_0107852 3300046529 Bacteria 2246
166 Ga0495640_0459033 3300046533 Bacteria 777
167 Ga0495634_0006041 3300046642 Bacteria 9236
168 Ga0495634_0421120 3300046642 Bacteria 791
169 Ga0495635_0135819 3300046663 Bacteria 1676
170 Ga0495657_0098619 3300046675 Bacteria 1864
171 Ga0495658_0122985 3300046683 Bacteria 1571
172 Ga0495658_0162363 3300046683 Bacteria 1379
173 Ga0495669_0076744 3300046684 Bacteria 1530
174 Ga0495600_0538716 3300046809 Bacteria 714
175 Ga0495604_0266502 3300047317 Bacteria 1162
176 Ga0495674_0456163 3300047319 Bacteria 1027
177 Ga0495680_0011218 3300047322 Bacteria 7957
178 Ga0495684_0203682 3300047471 Bacteria 1458
179 Ga0495602_0410836 3300048088 Bacteria 963
180 Ga0496102_1139589 3300048905 Bacteria 700
181 Ga0496103_0379850 3300048906 Bacteria 908
182 Ga0496104_0007312 3300048907 Bacteria 9746
183 Ga0496104_0842598 3300048907 Bacteria 822
184 Ga0496106_0219306 3300048909 Bacteria 1517
185 Ga0496107_0242567 3300048910 Bacteria 1341
186 Ga0496108_0021920 3300048911 Bacteria 5251
187 Ga0496108_0088147 3300048911 Bacteria 2636
188 Ga0496109_0006938 3300048912 Bacteria 9560
189 Ga0496110_0024203 3300048913 Bacteria 5172
190 Ga0496110_0141701 3300048913 Bacteria 2173
191 Ga0496110_0370174 3300048913 Bacteria 1306
192 Ga0496111_0001469 3300048914 Bacteria 13485
193 Ga0496111_0010459 3300048914 Bacteria 6227
194 Ga0496112_0061611 3300048915 Bacteria 3699
195 Ga0496112_1027732 3300048915 Bacteria 743
196 Ga0496113_0017783 3300048916 Bacteria 4942
197 Ga0496113_0632806 3300048916 Bacteria 856
198 Ga0496114_0140880 3300048917 Bacteria 2088
199 Ga0501034_0913454 3300049571 Unclassified 765
200 Ga0501038_0675238 3300049574 Bacteria 776
201 Ga0501043_0875696 3300049579 Unclassified 645
202 Ga0501067_0022113 3300049583 Bacteria 3519
203 Ga0501069_0128555 3300049585 Bacteria 1450
204 Ga0501069_0197045 3300049585 Bacteria 1166
205 Ga0501070_0069656 3300049586 Bacteria 2912
206 Ga0501070_0121619 3300049586 Bacteria 2157
207 Ga0501070_0134808 3300049586 Bacteria 2039
208 Ga0501080_0024500 3300049742 Bacteria 5593
209 Ga0501044_0033093 3300049823 Bacteria 5432
210 nmdc:mga0yw44_484990_c1 3300050492 Bacteria 838
211 nmdc:mga05p37_297084_c1 3300050507 Bacteria 1920
212 nmdc:mga09592_62115_c1 3300050508 Bacteria 3160
213 nmdc:mga0qj67_154963_c1 3300050509 Bacteria 1859
214 nmdc:mga06r32_276087_c1 3300050510 Bacteria 1668
215 nmdc:mga06r32_293165_c1 3300050510 Bacteria 1613
216 nmdc:mga08x19_336506_c1 3300050514 Bacteria 1052
217 Ga0495595_0377401 3300053084 Bacteria 717
218 Ga0495619_0329605 3300053085 Bacteria 1057
219 Ga0163163_10254232
220 Ga0070683_101173701
221 Ga0070680_100016366
222 Ga0070660_100090667
223 Ga0070691_10426327
224 Ga0070661_100038581
225 Ga0070692_10112598
226 Ga0070669_100258545
227 Ga0070671_100662260
228 Ga0070673_101528024
229 Ga0070659_100001945
230 Ga0070659_100162519
231 Ga0070709_10205655
232 Ga0070713_100265936
233 Ga0070710_10048557
234 Ga0070701_10024013
235 Ga0070708_100786339
236 Ga0070678_100179052
237 Ga0070681_10032229
238 Ga0068867_100053591
239 Ga0070685_10349752
240 Ga0070707_100356056
241 Ga0070707_100406865
242 Ga0070698_100919682
243 Ga0070679_100628734
244 Ga0070684_100035019
245 Ga0070684_100738065
246 Ga0068853_100261000
247 Ga0068853_100595146
248 Ga0070696_100338308
249 Ga0070704_100184036
250 Ga0070664_100041201
251 Ga0070664_100089467
252 Ga0068857_100083185
253 Ga0068854_100021954
254 Ga0068856_100017141
255 Ga0070702_100116058
256 Ga0068852_100003560
257 Ga0068864_100001227
258 Ga0068864_100912231
259 Ga0068866_10614435
260 Ga0068861_101066708
261 Ga0068863_100010885
262 Ga0068860_100928905
263 Ga0081455_10230901
264 Ga0081540_1000958
265 Ga0081539_10014111
266 Ga0075428_100038291
267 Ga0075428_100291125
268 Ga0075428_100442113
269 Ga0075430_100050525
270 Ga0075430_100089734
271 Ga0075431_100029010
272 Ga0075431_100271661
273 Ga0075429_100093798
274 Ga0075436_100259482
275 Ga0105240_10116787
276 Ga0105245_10525900
277 Ga0105245_10623051
278 Ga0105247_10297358
279 Ga0114129_10733771
280 Ga0114129_11210513
281 Ga0105242_10174388
282 Ga0105248_10035489
283 Ga0105237_10164349
284 Ga0105238_10020434
285 Ga0105239_10090942
286 Ga0105246_10313750
287 Ga0157370_10008970
288 Ga0157369_10014358
289 Ga0157374_10047709
290 Ga0163162_10158765
291 Ga0157372_10086822
292 Ga0157375_10001210
293 Ga0157375_10052822
294 Ga0163163_10120361
295 Ga0157376_10318509
296 Ga0157376_10438128
297 Ga0206354_10339989
298 Ga0206353_10394525
299 Ga0224712_10081306
300 Ga0207699_10105355
301 Ga0207699_10184029
302 Ga0207695_10139823
303 Ga0207693_10041184
304 Ga0207663_10232035
305 Ga0207660_10008676
306 Ga0207657_10044288
307 Ga0207657_10148817
308 Ga0207649_10025308
309 Ga0207652_10072724
310 Ga0207646_10146368
311 Ga0207646_10867031
312 Ga0207700_10262499
313 Ga0207644_10602614
314 Ga0207690_10028787
315 Ga0207669_10087537
316 Ga0207711_10104438
317 Ga0207661_10001895
318 Ga0207661_10578606
319 Ga0207661_11008127
320 Ga0207679_10011546
321 Ga0207679_10025494
322 Ga0207679_10090001
323 Ga0207639_10146949
324 Ga0207639_10277886
325 Ga0207702_10250051
326 Ga0207648_10005701
327 Ga0207676_10540933
328 Ga0207674_10283848
329 Ga0207674_10891032
330 Ga0207675_100175440
331 Ga0207698_10330275
332 Ga0265318_10010263
333 Ga0265324_10055739
334 Ga0265328_10042357
335 Ga0265320_10067311
336 Ga0265340_10008699
337 Ga0265340_10061871
338 Ga0265316_10032430
339 Ga0307406_10103562
340 Ga0307415_100333175
341 Ga0373949_0000002
342 Ga0373947_0584293
343 Ga0395899_0019038
344 Ga0395899_0021620
345 Ga0395899_0057233
346 Ga0395900_0019916
347 Ga0395900_0523324
348 Ga0395900_0562316
349 Ga0395898_0011129
350 Ga0395898_0018430
351 Ga0395898_0035903
352 Ga0395898_0071238
353 Ga0395898_0440921
354 Ga0395898_0490935
355 Ga0395905_0010592
356 Ga0395905_0013096
357 Ga0395905_0035645
358 Ga0395905_0059739
359 Ga0395905_0061686
360 Ga0395905_0786435
361 Ga0395901_0004228
362 Ga0395901_0005173
363 Ga0395901_0007676
364 Ga0395901_0017945
365 Ga0395901_0039877
366 Ga0395901_0101028
367 Ga0395901_0196633
368 Ga0395901_0303072
369 Ga0395901_0390526
370 Ga0466965_0000009
371 Ga0466966_0105576
372 Ga0466963_0471298
373 Ga0466967_0084716
374 Ga0495592_0186642
375 Ga0495629_0240822
376 Ga0495641_0112206
377 Ga0495582_0077229
378 Ga0495639_0022324
379 Ga0495662_0065327
380 Ga0495608_0040629
381 Ga0495628_0159914
382 Ga0495630_0004309
383 Ga0495652_0107852
384 Ga0495640_0459033
385 Ga0495634_0006041
386 Ga0495634_0421120
387 Ga0495635_0135819
388 Ga0495657_0098619
389 Ga0495658_0122985
390 Ga0495658_0162363
391 Ga0495669_0076744
392 Ga0495600_0538716
393 Ga0495604_0266502
394 Ga0495674_0456163
395 Ga0495680_0011218
396 Ga0495684_0203682
397 Ga0495602_0410836
398 Ga0496102_1139589
399 Ga0496103_0379850
400 Ga0496104_0007312
401 Ga0496104_0842598
402 Ga0496106_0219306
403 Ga0496107_0242567
404 Ga0496108_0021920
405 Ga0496108_0088147
406 Ga0496109_0006938
407 Ga0496110_0024203
408 Ga0496110_0141701
409 Ga0496110_0370174
410 Ga0496111_0001469
411 Ga0496111_0010459
412 Ga0496112_0061611
413 Ga0496112_1027732
414 Ga0496113_0017783
415 Ga0496113_0632806
416 Ga0496114_0140880
417 Ga0501034_0913454
418 Ga0501038_0675238
419 Ga0501043_0875696
420 Ga0501067_0022113
421 Ga0501069_0128555
422 Ga0501069_0197045
423 Ga0501070_0069656
424 Ga0501070_0121619
425 Ga0501070_0134808
426 Ga0501080_0024500
427 Ga0501044_0033093
428 nmdc:mga0yw44_484990_c1
429 nmdc:mga05p37_297084_c1
430 nmdc:mga09592_62115_c1
431 nmdc:mga0qj67_154963_c1
432 nmdc:mga06r32_276087_c1
433 nmdc:mga06r32_293165_c1
434 nmdc:mga08x19_336506_c1
435 Ga0495595_0377401
436 Ga0495619_0329605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

18

195

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7555 2 184
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7526 1 182
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7513 2 184
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7501 1 184
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7471 1 184
ID Description Score Start End Superfamily
af_Q5JKW4_92_204_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.8322 164 184 2.30.130.40
af_F7FH45_6_315_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7987 164 183 1.10.510.10
af_P0AFV2_139_215_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.795 162 184 3.30.70.260
af_Q86C56_1_188_3.90.1520.10 Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain 0.7865 162 183 3.90.1520.10
af_Q4DZ91_511_627_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7746 161 183 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A843TE17-F1-model_v4 Deaminase 0.9786 131 184 GO:0008703
GO:0009231
AF-A0A3P5WHC4-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9754 27 184 GO:0008703
GO:0009231
AF-A0A535DLF3-F1-model_v4 Deaminase 0.9749 27 184 GO:0008703
GO:0009231
AF-A0A7V9J129-F1-model_v4 Dihydrofolate reductase family protein 0.97 49 184 GO:0008703
GO:0009231
AF-A0A3C1DM52-F1-model_v4 Deaminase 0.967 98 184 GO:0008703
GO:0009231

Map