F329965

General Info

Members Datasets Scaffolds Average Seq Length
218 135 436 183

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10229822|Ga0157375_102298222
Length 196
Sequence MQIARLKDVAVLPIRIMGDPVLHAPASPVEDITDEIRALVADLFETMDAAPGVGLAAPQVGVPLRIYTYSYSDDDGSPWRGVIINPELWMRPMEPGDPDPDDESEGCLSFPGERFPLRRSEAVLVTGIDLEGAPVRVEVEGWRARIMQHEFDHLDGVLYVDRLGDSDWKTVQKIARKRGWGRPGQAWTPGIDNLEP

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
42 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
43 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
47 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
52 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
53 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
54 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
55 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
56 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
57 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
58 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
59 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
60 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
63 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
64 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
65 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
66 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
67 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
68 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
69 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
70 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
71 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
72 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
73 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
74 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
75 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
76 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
81 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
82 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
83 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
84 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
85 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
86 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
87 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
88 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
89 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
90 2643221546 Microbacterium sp. Root53 Isolate Unclassified
91 2643221566 Microbacterium sp. Root166 Isolate Unclassified
92 2643221575 Microbacterium sp. Root61 Isolate Unclassified
93 2643221597 Microbacterium sp. Root180 Isolate Unclassified
94 2643221630 Microbacterium sp. Root322 Isolate Unclassified
95 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
96 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
97 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
98 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
99 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
100 2773857759 Microbacterium sp. 1294 Isolate Unclassified
101 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
102 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
103 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
104 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
105 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
106 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
107 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
108 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
109 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
110 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
111 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
112 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
113 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
114 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
115 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
116 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
117 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
118 2919069694 Microbacterium sp. 1154 Isolate Unclassified
119 2919395869 Microbacterium resistens 2980 Isolate Unclassified
120 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
121 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
122 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
123 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
124 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
125 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
126 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
127 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
128 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
129 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
130 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
131 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
132 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
133 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
134 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
135 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.52
Metatranscriptomes 0.46
Isolates 22.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 8.72
Nodule 0
Rhizoplane 12.39
Rhizosphere 38.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10229822 3300013308 Bacteria 2014
2 JGI25154J39366_1002696 3300002738 Bacteria 4331
3 Ga0006562J51391_1040361 3300003578 Bacteria 3670
4 Ga0070658_10732577 3300005327 Bacteria 859
5 Ga0070660_100138683 3300005339 Bacteria 1950
6 Ga0070685_10888799 3300005466 Bacteria 662
7 Ga0070679_100111927 3300005530 Bacteria 2716
8 Ga0070665_100073021 3300005548 Bacteria 3438
9 Ga0075365_10000821 3300006038 Bacteria 12815
10 Ga0075365_10007107 3300006038 Bacteria 6243
11 Ga0075363_100018933 3300006048 Bacteria 3436
12 Ga0075364_10076949 3300006051 Bacteria 2202
13 Ga0075364_10147997 3300006051 Bacteria 1582
14 Ga0075364_10217872 3300006051 Bacteria 1295
15 Ga0075367_10002793 3300006178 Bacteria 8095
16 Ga0075369_10030280 3300006186 Bacteria 2278
17 Ga0075370_10017919 3300006353 Bacteria 3833
18 Ga0105244_10049001 3300009036 Bacteria 2161
19 Ga0105243_10121741 3300009148 Bacteria 2201
20 Ga0105237_10200071 3300009545 Bacteria 1997
21 Ga0105239_11345207 3300010375 Bacteria 824
22 Ga0157370_10140898 3300013104 Bacteria 2247
23 Ga0157370_11223700 3300013104 Bacteria 677
24 Ga0157369_10417516 3300013105 Bacteria 1391
25 Ga0157369_10919557 3300013105 Bacteria 897
26 Ga0157369_10926785 3300013105 Bacteria 893
27 Ga0171462_1003 3300013250 Bacteria 853796
28 Ga0163162_10129477 3300013306 Bacteria 2632
29 Ga0157375_10096291 3300013308 Bacteria 3032
30 Ga0157380_10263400 3300014326 Bacteria 1567
31 Ga0157380_10898299 3300014326 Bacteria 912
32 Ga0163161_10188337 3300017792 Bacteria 1585
33 Ga0163161_10638982 3300017792 Bacteria 881
34 Ga0209646_1000071 3300025246 Bacteria 228702
35 Ga0207655_1071159 3300025728 Bacteria 1292
36 Ga0207705_10637292 3300025909 Bacteria 829
37 Ga0207652_10132605 3300025921 Bacteria 2223
38 Ga0207709_10208269 3300025935 Bacteria 1401
39 Ga0207639_10059385 3300026041 Bacteria 2946
40 Ga0268266_10119210 3300028379 Bacteria 2347
41 Ga0307405_10117744 3300031731 Bacteria 1812
42 Ga0307405_11266765 3300031731 Bacteria 640
43 Ga0307406_10000123 3300031901 Bacteria 45640
44 Ga0307406_10000186 3300031901 Bacteria 37012
45 Ga0307406_10052303 3300031901 Bacteria 2597
46 Ga0307406_10075184 3300031901 Bacteria 2228
47 Ga0307412_10100776 3300031911 Bacteria 2042
48 Ga0307412_10240538 3300031911 Bacteria 1400
49 Ga0307412_10698511 3300031911 Bacteria 870
50 Ga0307412_10878792 3300031911 Bacteria 784
51 Ga0307412_10897888 3300031911 Bacteria 776
52 Ga0307409_100084717 3300031995 Bacteria 2575
53 Ga0307416_100265563 3300032002 Bacteria 1681
54 Ga0307416_100442595 3300032002 Bacteria 1350
55 Ga0307414_10086325 3300032004 Bacteria 2315
56 Ga0307414_10266207 3300032004 Bacteria 1433
57 Ga0307414_10951858 3300032004 Bacteria 789
58 Ga0307414_11131714 3300032004 Bacteria 723
59 Ga0307415_100030075 3300032126 Bacteria 3480
60 Ga0395898_0080600 3300037466 Bacteria 3139
61 Ga0395901_0094305 3300038443 Bacteria 3135
62 Ga0451797_0126409 3300041453 Bacteria 726
63 Ga0451807_0140817 3300041486 Bacteria 846
64 Ga0451807_1041721 3300041486 Bacteria 1203
65 Ga0451807_1190923 3300041486 Bacteria 972
66 Ga0451853_0301463 3300041512 Bacteria 620
67 Ga0451853_3720723 3300041512 Bacteria 1088
68 Ga0451853_3900129 3300041512 Bacteria 594
69 Ga0466972_0051153 3300044658 Bacteria 1994
70 Ga0466965_0015383 3300044683 Bacteria 3635
71 Ga0466965_0442441 3300044683 Bacteria 723
72 Ga0466968_0002302 3300044735 Bacteria 6977
73 Ga0466970_0000885 3300044765 Bacteria 14433
74 Ga0466957_0022056 3300044842 Bacteria 3755
75 Ga0466960_0016069 3300044901 Bacteria 3239
76 Ga0466958_0058280 3300045836 Bacteria 2348
77 Ga0495598_0142344 3300046537 Bacteria 831
78 Ga0495645_0060381 3300046543 Bacteria 2748
79 Ga0495645_0234801 3300046543 Bacteria 1227
80 Ga0495681_0102712 3300047470 Bacteria 1248
81 Ga0495686_0053228 3300047472 Bacteria 2537
82 Ga0496100_0140979 3300048903 Bacteria 1708
83 Ga0496100_0565899 3300048903 Bacteria 880
84 Ga0496101_0048004 3300048904 Bacteria 3066
85 Ga0496103_0065136 3300048906 Bacteria 2273
86 Ga0496103_0152167 3300048906 Bacteria 1482
87 Ga0496104_0082713 3300048907 Bacteria 3062
88 Ga0496104_0207787 3300048907 Bacteria 1870
89 Ga0496105_0173423 3300048908 Bacteria 1767
90 Ga0496105_0173874 3300048908 Bacteria 1765
91 Ga0496109_0468645 3300048912 Bacteria 1189
92 Ga0496110_0097991 3300048913 Bacteria 2627
93 Ga0496110_0140296 3300048913 Bacteria 2185
94 Ga0496111_0642538 3300048914 Bacteria 775
95 Ga0496112_0522262 3300048915 Bacteria 1122
96 Ga0496113_0053405 3300048916 Bacteria 3021
97 Ga0496113_0141507 3300048916 Bacteria 1893
98 Ga0496114_0035551 3300048917 Bacteria 4114
99 Ga0496114_0041819 3300048917 Bacteria 3798
100 Ga0496114_0051271 3300048917 Bacteria 3436
101 Ga0496114_0113561 3300048917 Bacteria 2322
102 Ga0496114_0312323 3300048917 Bacteria 1388
103 Ga0496114_0333488 3300048917 Bacteria 1341
104 Ga0496115_0094371 3300048918 Bacteria 2447
105 Ga0496117_0000053 3300048920 Bacteria 279396
106 Ga0496117_0001957 3300048920 Bacteria 27409
107 Ga0496117_0019673 3300048920 Bacteria 5534
108 Ga0496117_0237978 3300048920 Bacteria 1001
109 Ga0496118_0004020 3300048921 Bacteria 17887
110 Ga0496118_0011404 3300048921 Bacteria 8678
111 Ga0496118_0041898 3300048921 Bacteria 3619
112 Ga0496118_0337951 3300048921 Bacteria 809
113 Ga0496119_0001919 3300048922 Bacteria 23793
114 Ga0496119_0003805 3300048922 Bacteria 15428
115 Ga0496119_0006153 3300048922 Bacteria 11235
116 Ga0496119_0008929 3300048922 Bacteria 8707
117 Ga0496119_0052080 3300048922 Bacteria 2510
118 Ga0496119_0163198 3300048922 Bacteria 1182
119 Ga0496120_0000567 3300048923 Bacteria 56364
120 Ga0496120_0008926 3300048923 Bacteria 7180
121 Ga0496120_0041052 3300048923 Bacteria 2714
122 Ga0496120_0046278 3300048923 Bacteria 2515
123 Ga0496120_0166825 3300048923 Bacteria 1092
124 Ga0496121_0579782 3300048924 Bacteria 696
125 Ga0496122_0000030 3300048925 Bacteria 331586
126 Ga0496122_0000200 3300048925 Bacteria 133548
127 Ga0496122_0007477 3300048925 Bacteria 12125
128 Ga0496122_0072939 3300048925 Bacteria 2438
129 Ga0496122_0142002 3300048925 Bacteria 1500
130 Ga0496122_0258152 3300048925 Bacteria 969
131 Ga0496123_0000024 3300048926 Bacteria 331587
132 Ga0496123_0000076 3300048926 Bacteria 194050
133 Ga0496123_0031742 3300048926 Bacteria 3836
134 Ga0496123_0169163 3300048926 Bacteria 1155
135 Ga0496123_0219219 3300048926 Bacteria 961
136 Ga0496124_0004639 3300048927 Bacteria 15917
137 Ga0496124_0027137 3300048927 Bacteria 5146
138 Ga0496124_0174892 3300048927 Bacteria 1658
139 Ga0496124_0175809 3300048927 Bacteria 1653
140 Ga0496124_0296415 3300048927 Bacteria 1170
141 Ga0496124_0406656 3300048927 Bacteria 943
142 Ga0496125_0000061 3300048928 Bacteria 262739
143 Ga0496125_0003878 3300048928 Bacteria 17678
144 Ga0496125_0004791 3300048928 Bacteria 15401
145 Ga0496125_0008942 3300048928 Bacteria 10395
146 Ga0496125_0017584 3300048928 Bacteria 6811
147 Ga0496125_0035780 3300048928 Bacteria 4348
148 Ga0496125_0067957 3300048928 Bacteria 2805
149 Ga0496125_0213354 3300048928 Bacteria 1251
150 Ga0496126_0013774 3300048929 Bacteria 8202
151 Ga0496126_0015044 3300048929 Bacteria 7797
152 Ga0496126_0054042 3300048929 Bacteria 3640
153 Ga0496126_0124533 3300048929 Bacteria 2232
154 Ga0496126_0150604 3300048929 Bacteria 1994
155 Ga0501033_0343654 3300049570 Bacteria 1046
156 Ga0501034_0007703 3300049571 Bacteria 11458
157 Ga0501034_0534245 3300049571 Bacteria 1083
158 Ga0501038_0006092 3300049574 Bacteria 11160
159 Ga0501038_0016990 3300049574 Bacteria 6585
160 Ga0501070_0011122 3300049586 Bacteria 7596
161 nmdc:mga03n38_16234_c1 3300050490 Bacteria 2893
162 nmdc:mga00v17_274727_c1 3300050491 Bacteria 1094
163 nmdc:mga00v17_42489_c1 3300050491 Bacteria 2734
164 nmdc:mga00v17_62268_c1 3300050491 Bacteria 2295
165 nmdc:mga0yw44_34184_c1 3300050492 Bacteria 2977
166 nmdc:mga0yw44_45850_c1 3300050492 Bacteria 2623
167 nmdc:mga06z11_31768_c1 3300050494 Bacteria 2569
168 nmdc:mga07m45_35337_c1 3300050496 Bacteria 2779
169 nmdc:mga0sz30_172179_c1 3300050516 Bacteria 960
170 Ga0500562_120638 3300053108 Bacteria 715
171 2588108519 2585428157 Bacteria 3018951
172 2643733515 2643221542 Bacteria 3563959
173 2643752292 2643221546 Bacteria 2910897
174 2643848279 2643221566 Bacteria 3460379
175 2643885408 2643221575 Bacteria 4022601
176 2643995716 2643221597 Bacteria 3347721
177 2644170090 2643221630 Bacteria 3601215
178 2644680407 2643221724 Bacteria 3593515
179 2730229861 2728369380 Bacteria 3620317
180 2747953458 2747842429 Bacteria 3914386
181 2758226108 2757320536 Bacteria 3629334
182 2774380369 2773857758 Bacteria 3592392
183 2774384532 2773857759 Bacteria 2963774
184 2774399522 2773857763 Bacteria 4180068
185 2808631174 2808606306 Bacteria 3608896
186 2808885658 2808606368 Bacteria 3174172
187 2809227452 2808606447 Bacteria 3572005
188 2812323128 2811994872 Bacteria 4121241
189 2821270022 2821268502 Bacteria 3750023
190 2833710971 2833709550 Bacteria 4008291
191 2852634210 2852632344 Bacteria 3463163
192 2852647483 2852646457 Bacteria 3408613
193 2852679156 2852677369 Bacteria 3768884
194 2857724036 2857723135 Bacteria 4217853
195 2857729984 2857729791 Bacteria 4040535
196 2870630370 2870628048 Bacteria 3696012
197 2897563214 2897561785 Bacteria 3256946
198 2904511985 2904509784 Bacteria 3520416
199 2906800715 2906799679 Bacteria 4031749
200 2908680903 2908678064 Bacteria 3482747
201 2919072627 2919069694 Bacteria 3622919
202 2919398777 2919395869 Bacteria 3704152
203 2928123206 2928121344 Bacteria 3972376
204 2939661297 2939660829 Bacteria 3784848
205 2945972000 2945968032 Bacteria 4111363
206 2946033622 2946033335 Bacteria 3835514
207 2946080783 2946080515 Bacteria 4310960
208 2974297199 2974294766 Bacteria 3767688
209 2974326567 2974324384 Bacteria 3750535
210 2977231431 2977228692 Bacteria 3450105
211 2977240204 2977236895 Bacteria 3569373
212 2977253879 2977251589 Bacteria 2952848
213 2977266642 2977264416 Bacteria 3750737
214 2984545519 2984542743 Bacteria 3569378
215 8004185019 8004182704 Bacteria 3391155
216 8004214337 8004212874 Bacteria 2861420
217 8016257529 8016254467 Bacteria 3797036
218 8045831605 8045830549 Bacteria 4444727
219 Ga0157375_10229822
220 JGI25154J39366_1002696
221 Ga0006562J51391_1040361
222 Ga0070658_10732577
223 Ga0070660_100138683
224 Ga0070685_10888799
225 Ga0070679_100111927
226 Ga0070665_100073021
227 Ga0075365_10000821
228 Ga0075365_10007107
229 Ga0075363_100018933
230 Ga0075364_10076949
231 Ga0075364_10147997
232 Ga0075364_10217872
233 Ga0075367_10002793
234 Ga0075369_10030280
235 Ga0075370_10017919
236 Ga0105244_10049001
237 Ga0105243_10121741
238 Ga0105237_10200071
239 Ga0105239_11345207
240 Ga0157370_10140898
241 Ga0157370_11223700
242 Ga0157369_10417516
243 Ga0157369_10919557
244 Ga0157369_10926785
245 Ga0171462_1003
246 Ga0163162_10129477
247 Ga0157375_10096291
248 Ga0157380_10263400
249 Ga0157380_10898299
250 Ga0163161_10188337
251 Ga0163161_10638982
252 Ga0209646_1000071
253 Ga0207655_1071159
254 Ga0207705_10637292
255 Ga0207652_10132605
256 Ga0207709_10208269
257 Ga0207639_10059385
258 Ga0268266_10119210
259 Ga0307405_10117744
260 Ga0307405_11266765
261 Ga0307406_10000123
262 Ga0307406_10000186
263 Ga0307406_10052303
264 Ga0307406_10075184
265 Ga0307412_10100776
266 Ga0307412_10240538
267 Ga0307412_10698511
268 Ga0307412_10878792
269 Ga0307412_10897888
270 Ga0307409_100084717
271 Ga0307416_100265563
272 Ga0307416_100442595
273 Ga0307414_10086325
274 Ga0307414_10266207
275 Ga0307414_10951858
276 Ga0307414_11131714
277 Ga0307415_100030075
278 Ga0395898_0080600
279 Ga0395901_0094305
280 Ga0451797_0126409
281 Ga0451807_0140817
282 Ga0451807_1041721
283 Ga0451807_1190923
284 Ga0451853_0301463
285 Ga0451853_3720723
286 Ga0451853_3900129
287 Ga0466972_0051153
288 Ga0466965_0015383
289 Ga0466965_0442441
290 Ga0466968_0002302
291 Ga0466970_0000885
292 Ga0466957_0022056
293 Ga0466960_0016069
294 Ga0466958_0058280
295 Ga0495598_0142344
296 Ga0495645_0060381
297 Ga0495645_0234801
298 Ga0495681_0102712
299 Ga0495686_0053228
300 Ga0496100_0140979
301 Ga0496100_0565899
302 Ga0496101_0048004
303 Ga0496103_0065136
304 Ga0496103_0152167
305 Ga0496104_0082713
306 Ga0496104_0207787
307 Ga0496105_0173423
308 Ga0496105_0173874
309 Ga0496109_0468645
310 Ga0496110_0097991
311 Ga0496110_0140296
312 Ga0496111_0642538
313 Ga0496112_0522262
314 Ga0496113_0053405
315 Ga0496113_0141507
316 Ga0496114_0035551
317 Ga0496114_0041819
318 Ga0496114_0051271
319 Ga0496114_0113561
320 Ga0496114_0312323
321 Ga0496114_0333488
322 Ga0496115_0094371
323 Ga0496117_0000053
324 Ga0496117_0001957
325 Ga0496117_0019673
326 Ga0496117_0237978
327 Ga0496118_0004020
328 Ga0496118_0011404
329 Ga0496118_0041898
330 Ga0496118_0337951
331 Ga0496119_0001919
332 Ga0496119_0003805
333 Ga0496119_0006153
334 Ga0496119_0008929
335 Ga0496119_0052080
336 Ga0496119_0163198
337 Ga0496120_0000567
338 Ga0496120_0008926
339 Ga0496120_0041052
340 Ga0496120_0046278
341 Ga0496120_0166825
342 Ga0496121_0579782
343 Ga0496122_0000030
344 Ga0496122_0000200
345 Ga0496122_0007477
346 Ga0496122_0072939
347 Ga0496122_0142002
348 Ga0496122_0258152
349 Ga0496123_0000024
350 Ga0496123_0000076
351 Ga0496123_0031742
352 Ga0496123_0169163
353 Ga0496123_0219219
354 Ga0496124_0004639
355 Ga0496124_0027137
356 Ga0496124_0174892
357 Ga0496124_0175809
358 Ga0496124_0296415
359 Ga0496124_0406656
360 Ga0496125_0000061
361 Ga0496125_0003878
362 Ga0496125_0004791
363 Ga0496125_0008942
364 Ga0496125_0017584
365 Ga0496125_0035780
366 Ga0496125_0067957
367 Ga0496125_0213354
368 Ga0496126_0013774
369 Ga0496126_0015044
370 Ga0496126_0054042
371 Ga0496126_0124533
372 Ga0496126_0150604
373 Ga0501033_0343654
374 Ga0501034_0007703
375 Ga0501034_0534245
376 Ga0501038_0006092
377 Ga0501038_0016990
378 Ga0501070_0011122
379 nmdc:mga03n38_16234_c1
380 nmdc:mga00v17_274727_c1
381 nmdc:mga00v17_42489_c1
382 nmdc:mga00v17_62268_c1
383 nmdc:mga0yw44_34184_c1
384 nmdc:mga0yw44_45850_c1
385 nmdc:mga06z11_31768_c1
386 nmdc:mga07m45_35337_c1
387 nmdc:mga0sz30_172179_c1
388 Ga0500562_120638
389 2588108519
390 2643733515
391 2643752292
392 2643848279
393 2643885408
394 2643995716
395 2644170090
396 2644680407
397 2730229861
398 2747953458
399 2758226108
400 2774380369
401 2774384532
402 2774399522
403 2808631174
404 2808885658
405 2809227452
406 2812323128
407 2821270022
408 2833710971
409 2852634210
410 2852647483
411 2852679156
412 2857724036
413 2857729984
414 2870630370
415 2897563214
416 2904511985
417 2906800715
418 2908680903
419 2919072627
420 2919398777
421 2928123206
422 2939661297
423 2945972000
424 2946033622
425 2946080783
426 2974297199
427 2974326567
428 2977231431
429 2977240204
430 2977253879
431 2977266642
432 2984545519
433 8004185019
434 8004214337
435 8016257529
436 8045831605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

11

169

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ws1-assembly1.cif.gz_A structure analysis of peptide deformylase from bacillus cereus 0.8374 6 148
6jf7-assembly1.cif.gz_B k3u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.8264 2 147
6jf4-assembly1.cif.gz_A k1u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.8239 2 146
5t8z-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia multivorans in complex with actinonin 0.8235 1 149
5cx0-assembly1.cif.gz_A-2 structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv. oryzae, in complex with fragment 322 0.822 1 151
ID Description Score Start End Superfamily
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8374 6 148 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8206 1 141 3.90.45.10
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.814 1 150 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8057 1 149 3.90.45.10
3uwaA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.7896 1 147 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A3C1KFF7-F1-model_v4 peptide deformylase (EC 3.5.1.88) 0.9098 1 135 GO:0006412
GO:0042586
GO:0043686
AF-A0A3C1KFF7-F1-model_v4 peptide deformylase (EC 3.5.1.88) 0.9033 1 135 GO:0006412
GO:0042586
GO:0043686
AF-A0A6L6DF34-F1-model_v4 peptide deformylase (EC 3.5.1.88) 0.8936 2 114 GO:0006412
GO:0042586
GO:0043686
AF-A0A6J7CUC7-F1-model_v4 peptide deformylase (EC 3.5.1.88) 0.8759 1 161 GO:0042586
GO:0043686
AF-A0A1F7ACE6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.8702 6 149 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map