F329769

General Info

Members Datasets Scaffolds Average Seq Length
218 105 436 125

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10002994|Ga0081538_1000299411
Length 141
Sequence VIVDSSAIVAILLKESGYERLLDRLAAADQVRTGAPTVVESSLVLVARLGHAGKTLLARFLQEAEIEVVEFTVDHWTIAADAYVAYGKGRHRAGLNFGDCMTYAVAKLAGEPLLCLGDDFPATDLELSPILPGGVPGRVEK

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
31 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
32 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
33 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
34 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
35 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
36 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
37 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
42 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
43 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
44 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
45 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
50 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
51 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
52 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
53 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
54 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
55 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
62 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
63 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
64 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
65 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
80 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
81 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
82 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
83 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
86 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
87 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
88 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
105 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.54
Stem 0
Stem Tuber 0
Unclassified 17.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10002994 3300005981 Bacteria 16094
2 JGI25407J50210_10012474 3300003373 Bacteria 2179
3 Ga0070713_101325397 3300005436 Bacteria 698
4 Ga0070708_100362928 3300005445 Bacteria 1365
5 Ga0070678_100213367 3300005456 Bacteria 1601
6 Ga0070706_100115394 3300005467 Bacteria 2500
7 Ga0070707_100074889 3300005468 Bacteria 3265
8 Ga0070707_101598677 3300005468 Bacteria 619
9 Ga0070684_102153059 3300005535 Unclassified 526
10 Ga0068858_100353841 3300005842 Bacteria 1407
11 Ga0068858_102469694 3300005842 Unclassified 513
12 Ga0081455_10008286 3300005937 Bacteria 10831
13 Ga0081455_10088295 3300005937 Bacteria 2519
14 Ga0081538_10001119 3300005981 Bacteria 28423
15 Ga0081538_10008176 3300005981 Bacteria 8927
16 Ga0081538_10008904 3300005981 Bacteria 8444
17 Ga0081539_10008026 3300005985 Bacteria 9359
18 Ga0081539_10066364 3300005985 Bacteria 1956
19 Ga0081539_10165548 3300005985 Unclassified 1050
20 Ga0070712_100380936 3300006175 Bacteria 1161
21 Ga0075428_100336828 3300006844 Bacteria 1620
22 Ga0075430_100103442 3300006846 Bacteria 2377
23 Ga0075430_100596696 3300006846 Bacteria 911
24 Ga0075431_100003028 3300006847 Bacteria 16263
25 Ga0075431_100036793 3300006847 Bacteria 5042
26 Ga0075431_100259962 3300006847 Bacteria 1762
27 Ga0075431_100735824 3300006847 Unclassified 962
28 Ga0075433_11438120 3300006852 Unclassified 596
29 Ga0075429_100005044 3300006880 Bacteria 11355
30 Ga0111539_10001515 3300009094 Bacteria 31011
31 Ga0111539_11241570 3300009094 Bacteria 865
32 Ga0114129_10021478 3300009147 Bacteria 9162
33 Ga0114129_11011969 3300009147 Bacteria 1046
34 Ga0114129_11833484 3300009147 Bacteria 737
35 Ga0105243_10604739 3300009148 Unclassified 1056
36 Ga0105242_10914208 3300009176 Unclassified 879
37 Ga0105248_12990617 3300009177 Unclassified 538
38 Ga0105238_10088819 3300009551 Bacteria 3077
39 Ga0105239_11471500 3300010375 Unclassified 787
40 Ga0163162_10426303 3300013306 Bacteria 1459
41 Ga0157375_11122184 3300013308 Unclassified 921
42 Ga0207646_10063665 3300025922 Bacteria 3292
43 Ga0207646_11358555 3300025922 Bacteria 619
44 Ga0207700_10543763 3300025928 Bacteria 1030
45 Ga0207683_10155682 3300026121 Bacteria 2064
46 Ga0207428_10042137 3300027907 Bacteria 3692
47 Ga0265328_10032736 3300031239 Bacteria 1929
48 Ga0307413_10958422 3300031824 Bacteria 730
49 Ga0307410_10645590 3300031852 Unclassified 887
50 Ga0307406_10441765 3300031901 Bacteria 1041
51 Ga0307407_10041336 3300031903 Bacteria 2578
52 Ga0307412_10142978 3300031911 Bacteria 1755
53 Ga0307409_100226497 3300031995 Bacteria 1691
54 Ga0307409_100518096 3300031995 Bacteria 1164
55 Ga0307416_100075213 3300032002 Bacteria 2825
56 Ga0307416_100628774 3300032002 Bacteria 1156
57 Ga0307411_10443885 3300032005 Bacteria 1084
58 Ga0307415_100044108 3300032126 Bacteria 2979
59 Ga0373934_0305908 3300035086 Unclassified 660
60 Ga0373933_0097571 3300035724 Unclassified 1820
61 Ga0373933_0519338 3300035724 Unclassified 781
62 Ga0373937_0003266 3300036401 Bacteria 13605
63 Ga0395899_0156004 3300037312 Bacteria 1615
64 Ga0395900_0009958 3300037418 Bacteria 9732
65 Ga0395898_0098638 3300037466 Bacteria 2805
66 Ga0395905_0001026 3300037471 Bacteria 35609
67 Ga0395905_0132684 3300037471 Bacteria 2343
68 Ga0395905_0437369 3300037471 Bacteria 1205
69 Ga0395901_0027741 3300038443 Bacteria 5822
70 Ga0395901_0459494 3300038443 Bacteria 1301
71 Ga0436365_1176312 3300039437 Bacteria 842
72 Ga0439443_114736 3300042003 Bacteria 525
73 Ga0439448_0025673 3300042005 Unclassified 1849
74 Ga0439448_0081819 3300042005 Bacteria 1085
75 Ga0439450_071665 3300042008 Bacteria 851
76 Ga0439450_128317 3300042008 Bacteria 656
77 Ga0439463_083071 3300042016 Bacteria 824
78 Ga0439463_105844 3300042016 Bacteria 726
79 Ga0439463_132357 3300042016 Bacteria 645
80 Ga0439458_0222196 3300042157 Bacteria 521
81 Ga0439464_0002180 3300042439 Bacteria 4791
82 Ga0466966_0126253 3300044684 Bacteria 1569
83 Ga0466961_0099766 3300044693 Bacteria 1830
84 Ga0466963_0002418 3300044694 Bacteria 10447
85 Ga0466968_0105538 3300044735 Bacteria 1262
86 Ga0466958_0001334 3300045836 Bacteria 11653
87 Ga0495664_0000007 3300046477 Bacteria 386710
88 Ga0495630_0000368 3300046517 Bacteria 35747
89 Ga0495657_0000133 3300046675 Bacteria 66508
90 Ga0495658_0542959 3300046683 Unclassified 744
91 Ga0495684_0011674 3300047471 Bacteria 6782
92 Ga0501031_0007161 3300049568 Bacteria 7282
93 Ga0501031_0134051 3300049568 Bacteria 1618
94 Ga0501032_0074679 3300049569 Unclassified 2259
95 Ga0501032_0410615 3300049569 Bacteria 869
96 Ga0501033_0013559 3300049570 Bacteria 6205
97 Ga0501033_0019471 3300049570 Bacteria 5133
98 Ga0501033_0871034 3300049570 Bacteria 606
99 Ga0501036_0006287 3300049572 Bacteria 9637
100 Ga0501036_0042078 3300049572 Bacteria 3867
101 Ga0501036_0066603 3300049572 Bacteria 3047
102 Ga0501036_0081928 3300049572 Bacteria 2727
103 Ga0501036_0343162 3300049572 Bacteria 1247
104 Ga0501036_0465454 3300049572 Unclassified 1053
105 Ga0501037_0012869 3300049573 Bacteria 6166
106 Ga0501037_0391916 3300049573 Bacteria 953
107 Ga0501037_0462568 3300049573 Bacteria 864
108 Ga0501038_0004492 3300049574 Bacteria 12973
109 Ga0501038_0011959 3300049574 Bacteria 7923
110 Ga0501038_0025873 3300049574 Bacteria 5228
111 Ga0501038_0511338 3300049574 Unclassified 917
112 Ga0501039_0008299 3300049575 Bacteria 7914
113 Ga0501039_0070264 3300049575 Bacteria 2720
114 Ga0501039_0352414 3300049575 Unclassified 1156
115 Ga0501039_0695828 3300049575 Unclassified 795
116 Ga0501039_1347663 3300049575 Unclassified 550
117 Ga0501040_0000947 3300049576 Bacteria 18310
118 Ga0501040_0093756 3300049576 Unclassified 2088
119 Ga0501040_0327811 3300049576 Bacteria 1095
120 Ga0501041_0001535 3300049577 Bacteria 12838
121 Ga0501041_0015741 3300049577 Bacteria 4492
122 Ga0501041_0076037 3300049577 Bacteria 2066
123 Ga0501042_0000402 3300049578 Bacteria 21890
124 Ga0501042_0000812 3300049578 Bacteria 17233
125 Ga0501042_0080213 3300049578 Bacteria 2338
126 Ga0501042_0541991 3300049578 Unclassified 845
127 Ga0501043_0226136 3300049579 Unclassified 1446
128 Ga0501043_0430079 3300049579 Bacteria 994
129 Ga0501043_0571934 3300049579 Bacteria 837
130 Ga0501046_0000945 3300049580 Bacteria 28480
131 Ga0501046_0486095 3300049580 Bacteria 885
132 Ga0501048_0001387 3300049582 Bacteria 18358
133 Ga0501048_0026368 3300049582 Bacteria 4231
134 Ga0501048_0148663 3300049582 Bacteria 1657
135 Ga0501048_0174524 3300049582 Bacteria 1523
136 Ga0501048_1200750 3300049582 Unclassified 545
137 Ga0501068_0082990 3300049584 Bacteria 1969
138 Ga0501068_0317082 3300049584 Bacteria 999
139 Ga0501068_1173808 3300049584 Unclassified 508
140 Ga0501070_0364458 3300049586 Bacteria 1172
141 Ga0501070_0715384 3300049586 Unclassified 791
142 Ga0501071_0028788 3300049587 Bacteria 3917
143 Ga0501071_0097701 3300049587 Bacteria 2162
144 Ga0501071_0139582 3300049587 Bacteria 1804
145 Ga0501071_0319259 3300049587 Unclassified 1179
146 Ga0501072_0012010 3300049588 Bacteria 6616
147 Ga0501072_0014202 3300049588 Bacteria 6103
148 Ga0501072_0093535 3300049588 Bacteria 2388
149 Ga0501072_0230342 3300049588 Unclassified 1476
150 Ga0501073_0328898 3300049589 Bacteria 1055
151 Ga0501074_0016938 3300049590 Bacteria 5287
152 Ga0501074_0077121 3300049590 Bacteria 2392
153 Ga0501074_0197403 3300049590 Bacteria 1434
154 Ga0501074_0403531 3300049590 Unclassified 969
155 Ga0501075_0000305 3300049591 Bacteria 27456
156 Ga0501075_0000524 3300049591 Bacteria 23176
157 Ga0501075_0193946 3300049591 Unclassified 1549
158 Ga0501075_0325852 3300049591 Unclassified 1170
159 Ga0501075_0586711 3300049591 Bacteria 850
160 Ga0501076_0000012 3300049592 Bacteria 113396
161 Ga0501076_0008896 3300049592 Bacteria 7386
162 Ga0501076_0055194 3300049592 Bacteria 3150
163 Ga0501076_0126736 3300049592 Bacteria 2069
164 Ga0501076_0338890 3300049592 Bacteria 1234
165 Ga0501077_0013617 3300049593 Bacteria 5099
166 Ga0501249_087441 3300049679 Unclassified 736
167 Ga0501079_0000750 3300049741 Bacteria 22050
168 Ga0501079_0024650 3300049741 Bacteria 4616
169 Ga0501079_0137159 3300049741 Bacteria 1905
170 Ga0501079_0429666 3300049741 Bacteria 1037
171 Ga0501079_0439307 3300049741 Bacteria 1024
172 Ga0501080_0108903 3300049742 Bacteria 2568
173 Ga0501080_0143726 3300049742 Bacteria 2205
174 Ga0501080_0277029 3300049742 Bacteria 1526
175 Ga0501080_0662602 3300049742 Bacteria 923
176 Ga0501081_0000764 3300049743 Bacteria 18872
177 Ga0501081_0000849 3300049743 Bacteria 18053
178 Ga0501081_0009041 3300049743 Bacteria 6477
179 Ga0501081_0035987 3300049743 Bacteria 3373
180 Ga0501081_0149437 3300049743 Bacteria 1678
181 Ga0501081_0367071 3300049743 Bacteria 1062
182 Ga0501083_0059525 3300049744 Bacteria 2555
183 Ga0501083_0337839 3300049744 Bacteria 979
184 Ga0501035_0039236 3300049822 Bacteria 4286
185 Ga0501035_0078383 3300049822 Bacteria 2919
186 Ga0501035_0324459 3300049822 Bacteria 1293
187 Ga0501044_0170120 3300049823 Unclassified 2151
188 Ga0501044_1221754 3300049823 Unclassified 619
189 Ga0501045_0000342 3300049824 Bacteria 27580
190 Ga0501045_0024625 3300049824 Bacteria 4322
191 Ga0501045_0053278 3300049824 Bacteria 2956
192 Ga0501045_0070334 3300049824 Bacteria 2574
193 nmdc:mga05p37_1077018_c1 3300050507 Unclassified 844
194 nmdc:mga05p37_427_c1 3300050507 Bacteria 45535
195 nmdc:mga09592_4700_c1 3300050508 Bacteria 11055
196 nmdc:mga0qj67_6193_c1 3300050509 Bacteria 8776
197 nmdc:mga06r32_316_c1 3300050510 Bacteria 40391
198 nmdc:mga06r32_414253_c1 3300050510 Bacteria 1329
199 nmdc:mga06r32_620750_c1 3300050510 Bacteria 1051
200 nmdc:mga06r32_74613_c1 3300050510 Bacteria 3289
201 nmdc:mga08y16_90_c1 3300050511 Bacteria 76458
202 Ga0495601_0001597 3300053077 Bacteria 12512
203 Ga0501084_0001984 3300054114 Bacteria 16338
204 Ga0501084_0005011 3300054114 Bacteria 10828
205 Ga0501084_0010708 3300054114 Bacteria 7589
206 Ga0501084_0644301 3300054114 Unclassified 894
207 Ga0501082_0001187 3300060353 Bacteria 22887
208 Ga0501082_0007936 3300060353 Bacteria 9170
209 Ga0501082_0021433 3300060353 Bacteria 5575
210 Ga0501082_0113964 3300060353 Bacteria 2341
211 Ga0501082_0286367 3300060353 Bacteria 1434
212 Ga0466962_0150019 3300061719 Bacteria 1131
213 Ga0530510_0000345 3300061734 Bacteria 29910
214 Ga0530510_0001112 3300061734 Bacteria 17860
215 Ga0530510_0073441 3300061734 Bacteria 2483
216 Ga0530510_0274290 3300061734 Bacteria 1259
217 Ga0530510_0310226 3300061734 Bacteria 1181
218 Ga0530510_0336333 3300061734 Bacteria 1133
219 Ga0081538_10002994
220 JGI25407J50210_10012474
221 Ga0070713_101325397
222 Ga0070708_100362928
223 Ga0070678_100213367
224 Ga0070706_100115394
225 Ga0070707_100074889
226 Ga0070707_101598677
227 Ga0070684_102153059
228 Ga0068858_100353841
229 Ga0068858_102469694
230 Ga0081455_10008286
231 Ga0081455_10088295
232 Ga0081538_10001119
233 Ga0081538_10008176
234 Ga0081538_10008904
235 Ga0081539_10008026
236 Ga0081539_10066364
237 Ga0081539_10165548
238 Ga0070712_100380936
239 Ga0075428_100336828
240 Ga0075430_100103442
241 Ga0075430_100596696
242 Ga0075431_100003028
243 Ga0075431_100036793
244 Ga0075431_100259962
245 Ga0075431_100735824
246 Ga0075433_11438120
247 Ga0075429_100005044
248 Ga0111539_10001515
249 Ga0111539_11241570
250 Ga0114129_10021478
251 Ga0114129_11011969
252 Ga0114129_11833484
253 Ga0105243_10604739
254 Ga0105242_10914208
255 Ga0105248_12990617
256 Ga0105238_10088819
257 Ga0105239_11471500
258 Ga0163162_10426303
259 Ga0157375_11122184
260 Ga0207646_10063665
261 Ga0207646_11358555
262 Ga0207700_10543763
263 Ga0207683_10155682
264 Ga0207428_10042137
265 Ga0265328_10032736
266 Ga0307413_10958422
267 Ga0307410_10645590
268 Ga0307406_10441765
269 Ga0307407_10041336
270 Ga0307412_10142978
271 Ga0307409_100226497
272 Ga0307409_100518096
273 Ga0307416_100075213
274 Ga0307416_100628774
275 Ga0307411_10443885
276 Ga0307415_100044108
277 Ga0373934_0305908
278 Ga0373933_0097571
279 Ga0373933_0519338
280 Ga0373937_0003266
281 Ga0395899_0156004
282 Ga0395900_0009958
283 Ga0395898_0098638
284 Ga0395905_0001026
285 Ga0395905_0132684
286 Ga0395905_0437369
287 Ga0395901_0027741
288 Ga0395901_0459494
289 Ga0436365_1176312
290 Ga0439443_114736
291 Ga0439448_0025673
292 Ga0439448_0081819
293 Ga0439450_071665
294 Ga0439450_128317
295 Ga0439463_083071
296 Ga0439463_105844
297 Ga0439463_132357
298 Ga0439458_0222196
299 Ga0439464_0002180
300 Ga0466966_0126253
301 Ga0466961_0099766
302 Ga0466963_0002418
303 Ga0466968_0105538
304 Ga0466958_0001334
305 Ga0495664_0000007
306 Ga0495630_0000368
307 Ga0495657_0000133
308 Ga0495658_0542959
309 Ga0495684_0011674
310 Ga0501031_0007161
311 Ga0501031_0134051
312 Ga0501032_0074679
313 Ga0501032_0410615
314 Ga0501033_0013559
315 Ga0501033_0019471
316 Ga0501033_0871034
317 Ga0501036_0006287
318 Ga0501036_0042078
319 Ga0501036_0066603
320 Ga0501036_0081928
321 Ga0501036_0343162
322 Ga0501036_0465454
323 Ga0501037_0012869
324 Ga0501037_0391916
325 Ga0501037_0462568
326 Ga0501038_0004492
327 Ga0501038_0011959
328 Ga0501038_0025873
329 Ga0501038_0511338
330 Ga0501039_0008299
331 Ga0501039_0070264
332 Ga0501039_0352414
333 Ga0501039_0695828
334 Ga0501039_1347663
335 Ga0501040_0000947
336 Ga0501040_0093756
337 Ga0501040_0327811
338 Ga0501041_0001535
339 Ga0501041_0015741
340 Ga0501041_0076037
341 Ga0501042_0000402
342 Ga0501042_0000812
343 Ga0501042_0080213
344 Ga0501042_0541991
345 Ga0501043_0226136
346 Ga0501043_0430079
347 Ga0501043_0571934
348 Ga0501046_0000945
349 Ga0501046_0486095
350 Ga0501048_0001387
351 Ga0501048_0026368
352 Ga0501048_0148663
353 Ga0501048_0174524
354 Ga0501048_1200750
355 Ga0501068_0082990
356 Ga0501068_0317082
357 Ga0501068_1173808
358 Ga0501070_0364458
359 Ga0501070_0715384
360 Ga0501071_0028788
361 Ga0501071_0097701
362 Ga0501071_0139582
363 Ga0501071_0319259
364 Ga0501072_0012010
365 Ga0501072_0014202
366 Ga0501072_0093535
367 Ga0501072_0230342
368 Ga0501073_0328898
369 Ga0501074_0016938
370 Ga0501074_0077121
371 Ga0501074_0197403
372 Ga0501074_0403531
373 Ga0501075_0000305
374 Ga0501075_0000524
375 Ga0501075_0193946
376 Ga0501075_0325852
377 Ga0501075_0586711
378 Ga0501076_0000012
379 Ga0501076_0008896
380 Ga0501076_0055194
381 Ga0501076_0126736
382 Ga0501076_0338890
383 Ga0501077_0013617
384 Ga0501249_087441
385 Ga0501079_0000750
386 Ga0501079_0024650
387 Ga0501079_0137159
388 Ga0501079_0429666
389 Ga0501079_0439307
390 Ga0501080_0108903
391 Ga0501080_0143726
392 Ga0501080_0277029
393 Ga0501080_0662602
394 Ga0501081_0000764
395 Ga0501081_0000849
396 Ga0501081_0009041
397 Ga0501081_0035987
398 Ga0501081_0149437
399 Ga0501081_0367071
400 Ga0501083_0059525
401 Ga0501083_0337839
402 Ga0501035_0039236
403 Ga0501035_0078383
404 Ga0501035_0324459
405 Ga0501044_0170120
406 Ga0501044_1221754
407 Ga0501045_0000342
408 Ga0501045_0024625
409 Ga0501045_0053278
410 Ga0501045_0070334
411 nmdc:mga05p37_1077018_c1
412 nmdc:mga05p37_427_c1
413 nmdc:mga09592_4700_c1
414 nmdc:mga0qj67_6193_c1
415 nmdc:mga06r32_316_c1
416 nmdc:mga06r32_414253_c1
417 nmdc:mga06r32_620750_c1
418 nmdc:mga06r32_74613_c1
419 nmdc:mga08y16_90_c1
420 Ga0495601_0001597
421 Ga0501084_0001984
422 Ga0501084_0005011
423 Ga0501084_0010708
424 Ga0501084_0644301
425 Ga0501082_0001187
426 Ga0501082_0007936
427 Ga0501082_0021433
428 Ga0501082_0113964
429 Ga0501082_0286367
430 Ga0466962_0150019
431 Ga0530510_0000345
432 Ga0530510_0001112
433 Ga0530510_0073441
434 Ga0530510_0274290
435 Ga0530510_0310226
436 Ga0530510_0336333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

1

125

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.9564 1 128
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.9554 2 128
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.9275 1 128
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.9202 2 128
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.8379 1 115
ID Description Score Start End Superfamily
af_P9WF81_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9689 1 126 3.40.50.1010
af_P9WF65_1_129_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9644 1 126 3.40.50.1010
af_P9WF57_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9571 1 126 3.40.50.1010
4xgqG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9554 2 128 3.40.50.1010
4xgrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9456 3 130 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7V9WKE5-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9953 1 127 GO:0000287
GO:0004540
GO:0090729
AF-T1CQZ5-F1-model_v4 PilT protein domain protein 0.9927 15 123
AF-A0A531KEC7-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9914 57 127
AF-A0A7V9ED42-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.989 1 100 GO:0004518
AF-A0A5Q4GDA8-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9887 1 127 GO:0000287
GO:0004540
GO:0090729

Map