F329697

General Info

Members Datasets Scaffolds Average Seq Length
218 131 436 73

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100005347|Ga0070697_1000053479
Length 88
Sequence LPVILAHPGYGMLSHMLLLSEKVLLGDSWLEVELHDDLRYRLRYGELVEHRNARRRVRGRSAAYEFRSVEQLRYDFERDVEAAGGRLG

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
46 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
62 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
63 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
64 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
65 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
66 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
70 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
99 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
131 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 0
Rhizosphere 99.54
Stem 0
Stem Tuber 0
Unclassified 11.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100005347 3300005536 Bacteria 9873
2 Ga0065707_10085712 3300005295 Bacteria 5941
3 Ga0070680_100576553 3300005336 Bacteria 965
4 Ga0070689_100414339 3300005340 Bacteria 1141
5 Ga0070687_100520260 3300005343 Unclassified 804
6 Ga0070673_100304511 3300005364 Bacteria 1404
7 Ga0070713_100843022 3300005436 Bacteria 880
8 Ga0070701_11139588 3300005438 Unclassified 551
9 Ga0070711_101378280 3300005439 Bacteria 613
10 Ga0070705_100018068 3300005440 Bacteria 3690
11 Ga0070705_100374391 3300005440 Bacteria 1046
12 Ga0070700_100271205 3300005441 Bacteria 1226
13 Ga0070694_100097732 3300005444 Bacteria 2072
14 Ga0070694_100115709 3300005444 Bacteria 1917
15 Ga0070694_100449522 3300005444 Bacteria 1017
16 Ga0070694_101041737 3300005444 Unclassified 680
17 Ga0070708_100722223 3300005445 Bacteria 937
18 Ga0070681_10020891 3300005458 Bacteria 6557
19 Ga0070681_10676715 3300005458 Bacteria 947
20 Ga0070706_100032346 3300005467 Bacteria 4825
21 Ga0070707_100883063 3300005468 Bacteria 858
22 Ga0070707_101001247 3300005468 Unclassified 801
23 Ga0070699_100022732 3300005518 Bacteria 5405
24 Ga0070679_101683686 3300005530 Bacteria 582
25 Ga0070684_100728932 3300005535 Bacteria 925
26 Ga0070697_100021112 3300005536 Bacteria 5157
27 Ga0070697_100875900 3300005536 Bacteria 796
28 Ga0070686_100184537 3300005544 Bacteria 1485
29 Ga0070686_100630870 3300005544 Bacteria 848
30 Ga0070686_100709902 3300005544 Unclassified 803
31 Ga0070695_100047842 3300005545 Bacteria 2733
32 Ga0070695_100050036 3300005545 Bacteria 2677
33 Ga0070695_100077250 3300005545 Bacteria 2194
34 Ga0070695_100228216 3300005545 Bacteria 1345
35 Ga0070696_100002104 3300005546 Bacteria 13090
36 Ga0070696_100553824 3300005546 Bacteria 922
37 Ga0070696_101114070 3300005546 Bacteria 664
38 Ga0070693_100249479 3300005547 Bacteria 1176
39 Ga0070704_100146285 3300005549 Bacteria 1852
40 Ga0070704_100409528 3300005549 Bacteria 1159
41 Ga0068856_100115404 3300005614 Bacteria 2685
42 Ga0070702_100100019 3300005615 Bacteria 1777
43 Ga0070702_100497998 3300005615 Unclassified 894
44 Ga0068864_101146724 3300005618 Unclassified 775
45 Ga0068866_10659982 3300005718 Bacteria 713
46 Ga0081539_10000188 3300005985 Bacteria 143987
47 Ga0075430_100682723 3300006846 Bacteria 846
48 Ga0075433_10065177 3300006852 Bacteria 3195
49 Ga0075433_10100413 3300006852 Bacteria 2562
50 Ga0075433_10584758 3300006852 Bacteria 981
51 Ga0075433_11219627 3300006852 Bacteria 653
52 Ga0075434_100001630 3300006871 Bacteria 19105
53 Ga0075434_100022419 3300006871 Bacteria 6151
54 Ga0075434_100152138 3300006871 Bacteria 2334
55 Ga0075434_100221411 3300006871 Bacteria 1912
56 Ga0075434_100540066 3300006871 Bacteria 1186
57 Ga0075434_101416657 3300006871 Bacteria 705
58 Ga0075429_100500343 3300006880 Bacteria 1065
59 Ga0068865_102111440 3300006881 Bacteria 512
60 Ga0075436_100004877 3300006914 Bacteria 9222
61 Ga0075436_100013371 3300006914 Bacteria 5622
62 Ga0075436_100019533 3300006914 Bacteria 4643
63 Ga0075436_100022133 3300006914 Bacteria 4366
64 Ga0075436_100390115 3300006914 Bacteria 1008
65 Ga0075435_100035448 3300007076 Bacteria 3960
66 Ga0075435_100140200 3300007076 Bacteria 2028
67 Ga0075435_100258572 3300007076 Bacteria 1483
68 Ga0075435_100308497 3300007076 Bacteria 1354
69 Ga0099794_10228060 3300007265 Bacteria 958
70 Ga0099794_10427899 3300007265 Unclassified 693
71 Ga0099794_10439900 3300007265 Unclassified 683
72 Ga0099795_10492562 3300007788 Unclassified 570
73 Ga0111539_10021238 3300009094 Bacteria 7993
74 Ga0114129_10762486 3300009147 Bacteria 1238
75 Ga0114129_11853996 3300009147 Bacteria 732
76 Ga0105243_11298249 3300009148 Bacteria 745
77 Ga0105242_10227952 3300009176 Bacteria 1668
78 Ga0099796_10220008 3300010159 Bacteria 778
79 Ga0157378_12903408 3300013297 Unclassified 531
80 Ga0213871_10090604 3300021441 Unclassified 886
81 Ga0207653_10078311 3300025885 Bacteria 1140
82 Ga0207684_10074098 3300025910 Bacteria 2892
83 Ga0207707_11042958 3300025912 Unclassified 669
84 Ga0207660_10882283 3300025917 Bacteria 730
85 Ga0207662_10189605 3300025918 Bacteria 1326
86 Ga0207646_10396651 3300025922 Bacteria 1246
87 Ga0207646_10409398 3300025922 Bacteria 1225
88 Ga0207700_10428002 3300025928 Bacteria 1164
89 Ga0207700_10904705 3300025928 Bacteria 790
90 Ga0207664_10618557 3300025929 Bacteria 973
91 Ga0207644_11277127 3300025931 Unclassified 617
92 Ga0207670_10172017 3300025936 Bacteria 1625
93 Ga0207670_10225645 3300025936 Bacteria 1436
94 Ga0207670_11492723 3300025936 Unclassified 574
95 Ga0207651_10685168 3300025960 Bacteria 902
96 Ga0207702_10115816 3300026078 Bacteria 2391
97 Ga0207675_101099060 3300026118 Unclassified 815
98 Ga0268265_10918834 3300028380 Bacteria 860
99 Ga0307416_100188388 3300032002 Bacteria 1942
100 Ga0316583_10005541 3300032133 Bacteria 4531
101 Ga0373928_0077865 3300035084 Bacteria 831
102 Ga0373923_0025854 3300035111 Bacteria 2331
103 Ga0373932_0025782 3300035112 Bacteria 1595
104 Ga0373932_0031576 3300035112 Bacteria 1477
105 Ga0373936_0154030 3300035113 Bacteria 998
106 Ga0373953_0204224 3300035117 Unclassified 855
107 Ga0373954_0000001 3300035118 Bacteria 158201
108 Ga0373956_0267852 3300035119 Bacteria 813
109 Ga0373955_0142567 3300035172 Bacteria 1406
110 Ga0373955_0204507 3300035172 Bacteria 1176
111 Ga0373955_0881308 3300035172 Bacteria 550
112 Ga0373942_0030706 3300035207 Bacteria 1417
113 Ga0373924_0009847 3300035410 Bacteria 3513
114 Ga0373931_0599983 3300035691 Bacteria 720
115 Ga0373931_0902999 3300035691 Unclassified 594
116 Ga0373933_0005099 3300035724 Bacteria 7165
117 Ga0373933_0166888 3300035724 Bacteria 1400
118 Ga0373933_0662960 3300035724 Bacteria 686
119 Ga0373937_0002024 3300036401 Bacteria 16919
120 Ga0373937_0104509 3300036401 Bacteria 2631
121 Ga0316582_0004025 3300036647 Bacteria 7346
122 Ga0316584_0274873 3300036712 Bacteria 1225
123 Ga0316581_0032114 3300037588 Bacteria 1583
124 Ga0436360_1181460 3300039438 Bacteria 1976
125 Ga0466960_0517531 3300044901 Bacteria 701
126 Ga0451576_0101679 3300045051 Bacteria 2989
127 Ga0451576_0427195 3300045051 Bacteria 1390
128 Ga0495592_0000274 3300046454 Bacteria 44078
129 Ga0495592_0497543 3300046454 Bacteria 757
130 Ga0495629_0164917 3300046459 Bacteria 1539
131 Ga0495629_0304741 3300046459 Bacteria 1091
132 Ga0495641_0344484 3300046461 Unclassified 673
133 Ga0495651_0713272 3300046462 Bacteria 624
134 Ga0495651_0917705 3300046462 Unclassified 535
135 Ga0495653_0256126 3300046463 Bacteria 1159
136 Ga0495582_0171182 3300046473 Bacteria 1236
137 Ga0495639_0060897 3300046475 Bacteria 1730
138 Ga0495639_0172286 3300046475 Bacteria 1051
139 Ga0495662_0015364 3300046476 Bacteria 3718
140 Ga0495662_0031701 3300046476 Bacteria 2553
141 Ga0495608_0013519 3300046511 Bacteria 5661
142 Ga0495608_0452774 3300046511 Bacteria 781
143 Ga0495608_0477174 3300046511 Unclassified 757
144 Ga0495618_0008843 3300046514 Bacteria 6082
145 Ga0495628_0000155 3300046516 Bacteria 59667
146 Ga0495630_0001341 3300046517 Bacteria 16911
147 Ga0495666_0008802 3300046526 Bacteria 5056
148 Ga0495666_0479775 3300046526 Unclassified 556
149 Ga0495652_0165973 3300046529 Bacteria 1709
150 Ga0495652_0205117 3300046529 Bacteria 1493
151 Ga0495640_0000470 3300046533 Bacteria 29526
152 Ga0495640_0017100 3300046533 Bacteria 5412
153 Ga0495586_0003028 3300046535 Bacteria 9061
154 Ga0495586_0545328 3300046535 Bacteria 669
155 Ga0495587_0032560 3300046536 Bacteria 3151
156 Ga0495587_0202946 3300046536 Bacteria 1121
157 Ga0495598_0063420 3300046537 Bacteria 1146
158 Ga0495621_0080609 3300046539 Bacteria 1213
159 Ga0495621_0151803 3300046539 Bacteria 912
160 Ga0495645_0033726 3300046543 Bacteria 3735
161 Ga0495645_0883728 3300046543 Bacteria 531
162 Ga0495667_0001302 3300046559 Bacteria 16361
163 Ga0495634_0003300 3300046642 Bacteria 13011
164 Ga0495635_0010007 3300046663 Bacteria 6631
165 Ga0495635_0170682 3300046663 Bacteria 1479
166 Ga0495635_0542431 3300046663 Bacteria 763
167 Ga0495659_0313856 3300046664 Bacteria 664
168 Ga0495657_0618559 3300046675 Bacteria 626
169 Ga0495599_0003173 3300046678 Bacteria 9574
170 Ga0495623_0309574 3300046679 Bacteria 870
171 Ga0495647_0335491 3300046681 Unclassified 686
172 Ga0495658_0012227 3300046683 Bacteria 4339
173 Ga0495658_0168603 3300046683 Bacteria 1354
174 Ga0495669_0149941 3300046684 Bacteria 1103
175 Ga0495613_0000960 3300046689 Bacteria 22044
176 Ga0495624_0025098 3300046690 Bacteria 3917
177 Ga0495600_0015921 3300046809 Bacteria 4764
178 Ga0495581_0491172 3300047315 Bacteria 714
179 Ga0495604_0001586 3300047317 Bacteria 18731
180 Ga0495604_0158670 3300047317 Bacteria 1600
181 Ga0495636_0000352 3300047318 Bacteria 17535
182 Ga0495674_0175309 3300047319 Bacteria 1787
183 Ga0495674_0788972 3300047319 Bacteria 740
184 Ga0495680_0000202 3300047322 Bacteria 64368
185 Ga0495680_0427565 3300047322 Unclassified 910
186 Ga0495675_0200730 3300047444 Bacteria 1214
187 Ga0495684_0841760 3300047471 Bacteria 596
188 Ga0495602_0538187 3300048088 Bacteria 811
189 nmdc:mga05p37_488438_c1 3300050507 Bacteria 1416
190 nmdc:mga09592_295617_c1 3300050508 Bacteria 1404
191 nmdc:mga09592_570064_c1 3300050508 Bacteria 971
192 nmdc:mga08y16_45414_c1 3300050511 Bacteria 4603
193 nmdc:mga0n895_1010656_c1 3300050512 Bacteria 812
194 nmdc:mga0n895_1067632_c1 3300050512 Bacteria 786
195 nmdc:mga0n895_1161146_c1 3300050512 Bacteria 747
196 nmdc:mga0n895_15290_c1 3300050512 Bacteria 6992
197 nmdc:mga0n895_178188_c1 3300050512 Bacteria 2156
198 nmdc:mga0n895_225358_c1 3300050512 Bacteria 1903
199 nmdc:mga0n895_313882_c1 3300050512 Bacteria 1589
200 nmdc:mga0n895_7610_c1 3300050512 Bacteria 9313
201 nmdc:mga0rr50_1316109_c1 3300050513 Unclassified 613
202 nmdc:mga0rr50_142510_c1 3300050513 Bacteria 1929
203 nmdc:mga0rr50_194086_c1 3300050513 Bacteria 1665
204 nmdc:mga0rr50_9372_c1 3300050513 Bacteria 6150
205 nmdc:mga08x19_102325_c1 3300050514 Bacteria 1902
206 nmdc:mga08x19_17452_c1 3300050514 Bacteria 4391
207 nmdc:mga08x19_18966_c1 3300050514 Bacteria 4217
208 nmdc:mga08x19_3053_c1 3300050514 Bacteria 10064
209 nmdc:mga08x19_310525_c1 3300050514 Bacteria 1096
210 nmdc:mga08x19_420452_c1 3300050514 Bacteria 939
211 nmdc:mga08x19_496071_c1 3300050514 Unclassified 862
212 nmdc:mga0a205_1422198_c1 3300050515 Bacteria 541
213 nmdc:mga0a205_31636_c1 3300050515 Bacteria 5071
214 nmdc:mga0a205_680550_c1 3300050515 Bacteria 879
215 Ga0495601_0001838 3300053077 Bacteria 11791
216 Ga0495601_0304304 3300053077 Bacteria 1038
217 Ga0495619_0242041 3300053085 Bacteria 1250
218 Ga0500614_135142 3300053123 Bacteria 735
219 Ga0070697_100005347
220 Ga0065707_10085712
221 Ga0070680_100576553
222 Ga0070689_100414339
223 Ga0070687_100520260
224 Ga0070673_100304511
225 Ga0070713_100843022
226 Ga0070701_11139588
227 Ga0070711_101378280
228 Ga0070705_100018068
229 Ga0070705_100374391
230 Ga0070700_100271205
231 Ga0070694_100097732
232 Ga0070694_100115709
233 Ga0070694_100449522
234 Ga0070694_101041737
235 Ga0070708_100722223
236 Ga0070681_10020891
237 Ga0070681_10676715
238 Ga0070706_100032346
239 Ga0070707_100883063
240 Ga0070707_101001247
241 Ga0070699_100022732
242 Ga0070679_101683686
243 Ga0070684_100728932
244 Ga0070697_100021112
245 Ga0070697_100875900
246 Ga0070686_100184537
247 Ga0070686_100630870
248 Ga0070686_100709902
249 Ga0070695_100047842
250 Ga0070695_100050036
251 Ga0070695_100077250
252 Ga0070695_100228216
253 Ga0070696_100002104
254 Ga0070696_100553824
255 Ga0070696_101114070
256 Ga0070693_100249479
257 Ga0070704_100146285
258 Ga0070704_100409528
259 Ga0068856_100115404
260 Ga0070702_100100019
261 Ga0070702_100497998
262 Ga0068864_101146724
263 Ga0068866_10659982
264 Ga0081539_10000188
265 Ga0075430_100682723
266 Ga0075433_10065177
267 Ga0075433_10100413
268 Ga0075433_10584758
269 Ga0075433_11219627
270 Ga0075434_100001630
271 Ga0075434_100022419
272 Ga0075434_100152138
273 Ga0075434_100221411
274 Ga0075434_100540066
275 Ga0075434_101416657
276 Ga0075429_100500343
277 Ga0068865_102111440
278 Ga0075436_100004877
279 Ga0075436_100013371
280 Ga0075436_100019533
281 Ga0075436_100022133
282 Ga0075436_100390115
283 Ga0075435_100035448
284 Ga0075435_100140200
285 Ga0075435_100258572
286 Ga0075435_100308497
287 Ga0099794_10228060
288 Ga0099794_10427899
289 Ga0099794_10439900
290 Ga0099795_10492562
291 Ga0111539_10021238
292 Ga0114129_10762486
293 Ga0114129_11853996
294 Ga0105243_11298249
295 Ga0105242_10227952
296 Ga0099796_10220008
297 Ga0157378_12903408
298 Ga0213871_10090604
299 Ga0207653_10078311
300 Ga0207684_10074098
301 Ga0207707_11042958
302 Ga0207660_10882283
303 Ga0207662_10189605
304 Ga0207646_10396651
305 Ga0207646_10409398
306 Ga0207700_10428002
307 Ga0207700_10904705
308 Ga0207664_10618557
309 Ga0207644_11277127
310 Ga0207670_10172017
311 Ga0207670_10225645
312 Ga0207670_11492723
313 Ga0207651_10685168
314 Ga0207702_10115816
315 Ga0207675_101099060
316 Ga0268265_10918834
317 Ga0307416_100188388
318 Ga0316583_10005541
319 Ga0373928_0077865
320 Ga0373923_0025854
321 Ga0373932_0025782
322 Ga0373932_0031576
323 Ga0373936_0154030
324 Ga0373953_0204224
325 Ga0373954_0000001
326 Ga0373956_0267852
327 Ga0373955_0142567
328 Ga0373955_0204507
329 Ga0373955_0881308
330 Ga0373942_0030706
331 Ga0373924_0009847
332 Ga0373931_0599983
333 Ga0373931_0902999
334 Ga0373933_0005099
335 Ga0373933_0166888
336 Ga0373933_0662960
337 Ga0373937_0002024
338 Ga0373937_0104509
339 Ga0316582_0004025
340 Ga0316584_0274873
341 Ga0316581_0032114
342 Ga0436360_1181460
343 Ga0466960_0517531
344 Ga0451576_0101679
345 Ga0451576_0427195
346 Ga0495592_0000274
347 Ga0495592_0497543
348 Ga0495629_0164917
349 Ga0495629_0304741
350 Ga0495641_0344484
351 Ga0495651_0713272
352 Ga0495651_0917705
353 Ga0495653_0256126
354 Ga0495582_0171182
355 Ga0495639_0060897
356 Ga0495639_0172286
357 Ga0495662_0015364
358 Ga0495662_0031701
359 Ga0495608_0013519
360 Ga0495608_0452774
361 Ga0495608_0477174
362 Ga0495618_0008843
363 Ga0495628_0000155
364 Ga0495630_0001341
365 Ga0495666_0008802
366 Ga0495666_0479775
367 Ga0495652_0165973
368 Ga0495652_0205117
369 Ga0495640_0000470
370 Ga0495640_0017100
371 Ga0495586_0003028
372 Ga0495586_0545328
373 Ga0495587_0032560
374 Ga0495587_0202946
375 Ga0495598_0063420
376 Ga0495621_0080609
377 Ga0495621_0151803
378 Ga0495645_0033726
379 Ga0495645_0883728
380 Ga0495667_0001302
381 Ga0495634_0003300
382 Ga0495635_0010007
383 Ga0495635_0170682
384 Ga0495635_0542431
385 Ga0495659_0313856
386 Ga0495657_0618559
387 Ga0495599_0003173
388 Ga0495623_0309574
389 Ga0495647_0335491
390 Ga0495658_0012227
391 Ga0495658_0168603
392 Ga0495669_0149941
393 Ga0495613_0000960
394 Ga0495624_0025098
395 Ga0495600_0015921
396 Ga0495581_0491172
397 Ga0495604_0001586
398 Ga0495604_0158670
399 Ga0495636_0000352
400 Ga0495674_0175309
401 Ga0495674_0788972
402 Ga0495680_0000202
403 Ga0495680_0427565
404 Ga0495675_0200730
405 Ga0495684_0841760
406 Ga0495602_0538187
407 nmdc:mga05p37_488438_c1
408 nmdc:mga09592_295617_c1
409 nmdc:mga09592_570064_c1
410 nmdc:mga08y16_45414_c1
411 nmdc:mga0n895_1010656_c1
412 nmdc:mga0n895_1067632_c1
413 nmdc:mga0n895_1161146_c1
414 nmdc:mga0n895_15290_c1
415 nmdc:mga0n895_178188_c1
416 nmdc:mga0n895_225358_c1
417 nmdc:mga0n895_313882_c1
418 nmdc:mga0n895_7610_c1
419 nmdc:mga0rr50_1316109_c1
420 nmdc:mga0rr50_142510_c1
421 nmdc:mga0rr50_194086_c1
422 nmdc:mga0rr50_9372_c1
423 nmdc:mga08x19_102325_c1
424 nmdc:mga08x19_17452_c1
425 nmdc:mga08x19_18966_c1
426 nmdc:mga08x19_3053_c1
427 nmdc:mga08x19_310525_c1
428 nmdc:mga08x19_420452_c1
429 nmdc:mga08x19_496071_c1
430 nmdc:mga0a205_1422198_c1
431 nmdc:mga0a205_31636_c1
432 nmdc:mga0a205_680550_c1
433 Ga0495601_0001838
434 Ga0495601_0304304
435 Ga0495619_0242041
436 Ga0500614_135142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hxr-assembly1.cif.gz_A nucleoporin nup120 from s.cerevisiae (aa 1-757) 0.7423 3 28
3c0b-assembly1.cif.gz_A crystal structure of the conserved archaeal protein q6m145. northeast structural genomics consortium target mrr63 0.6458 1 27
3c0b-assembly2.cif.gz_D crystal structure of the conserved archaeal protein q6m145. northeast structural genomics consortium target mrr63 0.6343 1 27
5uz9-assembly1.cif.gz_K cryo em structure of anti-crisprs, acrf1 and acrf2, bound to type i-f crrna-guided crispr surveillance complex 0.6327 1 34
4kn5-assembly1.cif.gz_B crystal structure of a putative methylthioadenosine nucleosidase from weissella paramesenteroides atcc 33313 (target nysgrc-029342 ) 0.6094 1 31
ID Description Score Start End Superfamily
af_P77378_2_177_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7034 4 29 3.40.50.620
3no1F01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.6776 1 27 3.30.390.10
3wiqA03 Mainly Beta;Sandwich;Maltose phosphorylase, domain 3;Maltose phosphorylase, domain 3 0.6469 2 27 2.60.420.10
af_A0A0R4ISF7_691_829_2.60.120.830 Mainly Beta;Sandwich;Jelly Rolls; 0.6429 2 28 2.60.120.830
af_Q05040_205_519_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6398 1 26 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A537EG46-F1-model_v4 Uncharacterized protein 0.9769 1 71
AF-A0A537EG46-F1-model_v4 Uncharacterized protein 0.9636 1 71
AF-A0A1F4FGW4-F1-model_v4 KTSC domain-containing protein 0.9448 1 68
AF-A0A1F4FGW4-F1-model_v4 KTSC domain-containing protein 0.9065 1 68
AF-A0A5C5WWY6-F1-model_v4 Uncharacterized protein 0.8669 3 46

Map