F329293

General Info

Members Datasets Scaffolds Average Seq Length
217 170 162 316

Family's Representative Sequence

Representative Sequence 3300053083|Ga0495655_0032519|Ga0495655_0032519_101_1048
Length 315
Sequence MTIDNLKTPTIALGTWAWGDSGKIGDGYFGSHMTQAGLEEVADKAHAAGFNLWDTALVYGNGRSETVLGEVLKRYARSDYQLSTKFNPRIAGTSDDPAADMLEQSLANLGTDYIDLYWIHNPADVPRWTPHLIPLLKSGKVKHIGVSNHNLSEIKLADQILGEAGFRVEAIQNHFSLLYRSSEYAGILDYCHNQSIPFFAYMEQGALTGKYSPDNPLPEGSSRAKIYNGMLAQLKALTDKLASIGQSQGAAAPDVATAWAIAKGTTPIIGVTKPHHVDGLVRASSITLTSDDIAELEALADAANVNTRGFWEQEM

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2547132424 Nocardia nova SH22a Isolate Unclassified
9 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
10 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
11 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
12 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
13 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
14 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
15 2808606448 Streptomyces sp. 193411 Isolate Unclassified
16 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
17 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
18 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
19 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
20 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
21 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
22 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
23 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
24 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
25 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
26 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
27 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
28 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
29 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
30 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
31 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
32 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
33 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
34 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
35 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
36 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
37 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
38 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
39 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
40 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
41 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
42 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
43 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
44 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
45 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
46 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
47 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
48 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
49 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
50 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
51 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
54 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
55 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
56 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
57 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
58 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
59 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
60 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
61 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
62 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
63 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
64 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
65 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
66 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
67 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
68 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
69 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
70 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
162 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
165 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
166 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
167 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
168 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
169 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
170 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.65
Metatranscriptomes 0
Isolates 25.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.12
Nodule 14.75
Rhizoplane 0.46
Rhizosphere 47.93
Stem 0
Stem Tuber 0
Unclassified 14.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000032 3300001979 Bacteria 46815
2 JGI25158J39367_1001090 3300002739 Bacteria 4936
3 JGI25152J39213_1003458 3300002773 Bacteria 5385
4 JGI25152J39213_1007645 3300002773 Bacteria 2774
5 JGI25159J45721_1000895 3300002987 Bacteria 12970
6 JGI25153J46596_10011662 3300003215 Bacteria 3864
7 JGI25153J46596_10023032 3300003215 Bacteria 2279
8 rootH1_10003986 3300003316 Bacteria 7292
9 rootH2_10034773 3300003320 Bacteria 3507
10 rootH2_10206890 3300003320 Bacteria 1917
11 rootL2_10009173 3300003322 Bacteria 30207
12 rootL2_10138931 3300003322 Bacteria 2212
13 rootH1_10072531 3300003323 Bacteria 1805
14 JGI25160J50197_1013065 3300003354 Bacteria 2848
15 JGI25161J50226_1000150 3300003374 Bacteria 48475
16 Ga0055532_1000202 3300003758 Bacteria 48563
17 Ga0055525_1000274 3300003759 Bacteria 48089
18 Ga0055527_1000106 3300003760 Bacteria 60032
19 Ga0055535_1000210 3300003761 Bacteria 61721
20 Ga0055535_1000344 3300003761 Bacteria 46295
21 Ga0055542_1000166 3300003762 Bacteria 83233
22 Ga0055542_1000202 3300003762 Bacteria 73177
23 Ga0055529_1000181 3300003763 Bacteria 86692
24 Ga0055526_1002330 3300003771 Bacteria 12910
25 Ga0055524_1003057 3300003775 Bacteria 8281
26 Ga0055528_1003840 3300003790 Bacteria 7390
27 Ga0055528_1026279 3300003790 Bacteria 1678
28 Ga0055540_1004265 3300003792 Bacteria 6543
29 Ga0058692_1001318 3300003856 Bacteria 9328
30 Ga0058692_1016568 3300003856 Bacteria 1634
31 Ga0055543_1000074 3300004625 Bacteria 88424
32 Ga0065165_1010212 3300005262 Bacteria 4093
33 Ga0070658_10048785 3300005327 Bacteria 3429
34 Ga0070665_100015025 3300005548 Bacteria 7770
35 Ga0068855_100013803 3300005563 Bacteria 9738
36 Ga0068854_100004039 3300005578 Bacteria 9211
37 Ga0068856_100016251 3300005614 Bacteria 7200
38 Ga0068852_100370359 3300005616 Bacteria 1403
39 Ga0081455_10129747 3300005937 Bacteria 1973
40 Ga0070717_10021308 3300006028 Bacteria 5105
41 Ga0105240_10070735 3300009093 Unclassified 4316
42 Ga0105240_10243185 3300009093 Bacteria 2085
43 Ga0105241_10002652 3300009174 Bacteria 13402
44 Ga0105238_10032939 3300009551 Bacteria 5274
45 Ga0157370_10127530 3300013104 Bacteria 2375
46 Ga0157374_10500538 3300013296 Bacteria 1220
47 Ga0209436_100011 3300025208 Bacteria 139405
48 Ga0209672_100067 3300025228 Bacteria 180819
49 Ga0209672_100803 3300025228 Bacteria 14847
50 Ga0209147_100012 3300025229 Bacteria 681990
51 Ga0209563_100106 3300025230 Bacteria 146256
52 Ga0209258_100030 3300025242 Bacteria 470208
53 Ga0209258_100286 3300025242 Bacteria 83264
54 Ga0207425_1003202 3300025245 Bacteria 5347
55 Ga0209148_1000022 3300025254 Bacteria 681990
56 Ga0209148_1000135 3300025254 Bacteria 169939
57 Ga0209129_1002525 3300025258 Bacteria 8897
58 Ga0209129_1005567 3300025258 Bacteria 4398
59 Ga0209455_1000024 3300025272 Bacteria 676133
60 Ga0209455_1000495 3300025272 Bacteria 28763
61 Ga0209673_1000021 3300025273 Bacteria 422978
62 Ga0209673_1009774 3300025273 Bacteria 4113
63 Ga0209130_1000081 3300025284 Bacteria 166440
64 Ga0209564_1000225 3300025295 Bacteria 126209
65 Ga0209564_1002877 3300025295 Bacteria 12611
66 Ga0209758_1003268 3300025297 Bacteria 15030
67 Ga0209758_1009853 3300025297 Bacteria 5836
68 Ga0209256_1005028 3300025299 Bacteria 7892
69 Ga0207426_1000008 3300025302 Bacteria 848730
70 Ga0209051_1002199 3300025303 Bacteria 14416
71 Ga0207647_10029544 3300025904 Bacteria 3546
72 Ga0207699_10192878 3300025906 Bacteria 1376
73 Ga0207654_10032984 3300025911 Bacteria 2867
74 Ga0207695_10011795 3300025913 Bacteria 10547
75 Ga0207695_10072396 3300025913 Unclassified 3516
76 Ga0207671_10001887 3300025914 Bacteria 23289
77 Ga0207694_10022655 3300025924 Bacteria 4765
78 Ga0207694_10073271 3300025924 Bacteria 2679
79 Ga0207664_10000340 3300025929 Bacteria 34411
80 Ga0207640_10100537 3300025981 Bacteria 2026
81 Ga0207698_10086771 3300026142 Bacteria 2546
82 Ga0207698_10092395 3300026142 Bacteria 2480
83 Ga0209371_1000128 3300027312 Bacteria 124861
84 Ga0209371_1001770 3300027312 Bacteria 13556
85 Ga0209371_1004380 3300027312 Bacteria 6194
86 Ga0268266_10333305 3300028379 Bacteria 1422
87 Ga0268256_1000152 3300030500 Bacteria 92565
88 Ga0268256_1002022 3300030500 Bacteria 10968
89 Ga0268256_1009637 3300030500 Bacteria 3183
90 Ga0307513_10007967 3300031456 Bacteria 13629
91 Ga0307412_10000083 3300031911 Bacteria 91374
92 Ga0395898_0122381 3300037466 Bacteria 2493
93 Ga0395898_0211542 3300037466 Bacteria 1850
94 Ga0395905_0000314 3300037471 Bacteria 70335
95 Ga0395905_0001962 3300037471 Bacteria 23534
96 Ga0436365_0129053 3300039437 Bacteria 13412
97 Ga0466969_0014772 3300044656 Bacteria 4102
98 Ga0466969_0023291 3300044656 Bacteria 3191
99 Ga0466969_0026212 3300044656 Bacteria 2991
100 Ga0466972_0001274 3300044658 Bacteria 12159
101 Ga0466972_0009250 3300044658 Bacteria 4949
102 Ga0466982_0000001 3300044672 Bacteria 514662
103 Ga0466982_0086761 3300044672 Bacteria 1939
104 Ga0466965_0017177 3300044683 Bacteria 3455
105 Ga0466966_0004089 3300044684 Bacteria 9627
106 Ga0466961_0039880 3300044693 Bacteria 3010
107 Ga0466970_0002539 3300044765 Bacteria 8804
108 Ga0466957_0207582 3300044842 Bacteria 1289
109 Ga0466959_0002864 3300045049 Bacteria 11125
110 Ga0466959_0059594 3300045049 Bacteria 2780
111 Ga0466959_0192786 3300045049 Bacteria 1421
112 Ga0466958_0006439 3300045836 Bacteria 6389
113 Ga0466958_0075818 3300045836 Bacteria 2063
114 Ga0466967_0733118 3300045976 Bacteria 980
115 Ga0495651_0038181 3300046462 Bacteria 3739
116 Ga0495653_0132690 3300046463 Bacteria 1761
117 Ga0495628_0008496 3300046516 Bacteria 8800
118 Ga0495628_0039081 3300046516 Bacteria 3796
119 Ga0495643_0019991 3300046522 Bacteria 3868
120 Ga0495648_0037454 3300046524 Bacteria 3116
121 Ga0495652_0013048 3300046529 Bacteria 7488
122 Ga0495652_0180715 3300046529 Bacteria 1619
123 Ga0495623_0217269 3300046679 Bacteria 1091
124 Ga0495624_0075055 3300046690 Bacteria 2100
125 Ga0495600_0014916 3300046809 Bacteria 4905
126 Ga0495680_0043334 3300047322 Bacteria 3564
127 Ga0496117_0168735 3300048920 Bacteria 1273
128 Ga0496119_0000639 3300048922 Bacteria 47198
129 Ga0496119_0005725 3300048922 Bacteria 11780
130 Ga0496120_0170856 3300048923 Bacteria 1075
131 Ga0496122_0066820 3300048925 Bacteria 2594
132 Ga0496123_0102161 3300048926 Bacteria 1665
133 Ga0496124_0058037 3300048927 Bacteria 3257
134 Ga0496125_0077357 3300048928 Bacteria 2565
135 Ga0501031_0009572 3300049568 Bacteria 6309
136 Ga0501032_0008911 3300049569 Bacteria 7294
137 Ga0501032_0069003 3300049569 Bacteria 2359
138 Ga0501032_0153406 3300049569 Bacteria 1514
139 Ga0501036_0018828 3300049572 Bacteria 5791
140 Ga0501038_0074181 3300049574 Bacteria 2879
141 Ga0501042_0012471 3300049578 Bacteria 5760
142 Ga0501043_0019469 3300049579 Bacteria 5327
143 Ga0501043_0343961 3300049579 Bacteria 1134
144 Ga0501047_0000023 3300049581 Bacteria 240478
145 Ga0501047_0005761 3300049581 Bacteria 11666
146 Ga0501048_0293391 3300049582 Bacteria 1157
147 Ga0501067_0038560 3300049583 Bacteria 2653
148 Ga0501070_0314780 3300049586 Bacteria 1274
149 Ga0501073_0151267 3300049589 Bacteria 1609
150 Ga0501238_001722 3300049671 Bacteria 2547
151 Ga0501083_0130020 3300049744 Bacteria 1650
152 Ga0501035_0000362 3300049822 Bacteria 52504
153 Ga0501035_0005301 3300049822 Bacteria 12209
154 Ga0501035_0007701 3300049822 Bacteria 10060
155 Ga0501044_0004767 3300049823 Bacteria 15173
156 Ga0501044_0017320 3300049823 Bacteria 7727
157 Ga0501044_0025316 3300049823 Bacteria 6288
158 Ga0501044_0032415 3300049823 Bacteria 5493
159 Ga0495655_0032519 3300053083 Bacteria 1277
160 Ga0500633_0001408 3300053160 Bacteria 4505
161 Ga0466962_0009607 3300061719 Bacteria 4640
162 Ga0466962_0014554 3300061719 Bacteria 3791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2838029111 2838031665 257
2 iso_pu_bacteria 2842475841 2842478397 257
3 iso_pu_bacteria 2842502639 2842505657 257
4 3300045976 Ga0466967_0733118 Ga0466967_0733118_34_822 260
5 3300039437 Ga0436365_0129053 Ga0436365_0129053_10738_11649 303
6 iso_pu_bacteria 2547132424 2548698503 310
7 3300044658 Ga0466972_0009250 Ga0466972_0009250_2003_2938 311
8 iso_pu_bacteria 8055431914 8055434759 312
9 iso_pu_bacteria 2501025501 2501072210 313
10 iso_pu_bacteria 2501025502 2501077789 313
11 iso_pu_bacteria 2501025504 2501408903 313
12 iso_pu_bacteria 2510065045 2510251351 313
13 iso_pu_bacteria 2510917013 2511092243 313
14 iso_pu_bacteria 2510917014 2511098606 313
15 iso_pu_bacteria 2510917015 2511106368 313
16 iso_pu_bacteria 2551306166 2552107456 313
17 iso_pu_bacteria 2667528174 2671113142 313
18 iso_pu_bacteria 2687453130 2687581305 313
19 iso_pu_bacteria 2693429783 2694627893 313
20 iso_pu_bacteria 2693429784 2694636143 313
21 iso_pu_bacteria 2718217991 2719640469 313
22 iso_pu_bacteria 2808606448 2809229027 313
23 iso_pu_bacteria 2816332139 2816503829 313
24 iso_pu_bacteria 2818991448 2819611858 313
25 iso_pu_bacteria 2856364286 2856369884 313
26 iso_pu_bacteria 2863421361 2863426796 313
27 iso_pu_bacteria 2869285874 2869290691 313
28 iso_pu_bacteria 2871429161 2871432973 313
29 iso_pu_bacteria 2874146452 2874153866 313
30 iso_pu_bacteria 2874155637 2874161131 313
31 iso_pu_bacteria 2876377896 2876381876 313
32 iso_pu_bacteria 2876413966 2876419171 313
33 iso_pu_bacteria 2878745973 2878750586 313
34 iso_pu_bacteria 2888350351 2888350993 313
35 iso_pu_bacteria 2889010040 2889014897 313
36 iso_pu_bacteria 2903492973 2903499568 313
37 iso_pu_bacteria 2906308376 2906313511 313
38 iso_pu_bacteria 2906321335 2906326220 313
39 iso_pu_bacteria 2909399089 2909400084 313
40 iso_pu_bacteria 2909399089 2909400352 313
41 iso_pu_bacteria 2919408235 2919412910 313
42 iso_pu_bacteria 2937813078 2937820185 313
43 iso_pu_bacteria 2938014810 2938017163 313
44 iso_pu_bacteria 2958041894 2958046351 313
45 iso_pu_bacteria 2958071322 2958074010 313
46 iso_pu_bacteria 2958130278 2958135091 313
47 iso_pu_bacteria 2958179912 2958184120 313
48 iso_pu_bacteria 2961077736 2961082175 313
49 iso_pu_bacteria 2977843712 2977850272 313
50 iso_pu_bacteria 2979742915 2979751398 313
51 iso_pu_bacteria 2987652177 2987655775 313
52 iso_pu_bacteria 3005416602 3005423341 313
53 iso_pu_bacteria 8004387939 8004392980 313
54 iso_pu_bacteria 8004714634 8004719767 313
55 iso_pu_bacteria 8005314921 8005320860 313
56 iso_pu_bacteria 8005484373 8005486536 313
57 iso_pu_bacteria 8005682033 8005683479 313
58 iso_pu_bacteria 8057575449 8057580952 313
59 3300049569 Ga0501032_0069003 Ga0501032_0069003_506_1453 315
60 3300049583 Ga0501067_0038560 Ga0501067_0038560_1131_2078 315
61 3300049589 Ga0501073_0151267 Ga0501073_0151267_104_1051 315
62 3300049744 Ga0501083_0130020 Ga0501083_0130020_288_1235 315
63 3300053083 Ga0495655_0032519 Ga0495655_0032519_101_1048 315
64 3300003759 Ga0055525_1000274 Ga0055525_100027436 316
65 3300009551 Ga0105238_10032939 Ga0105238_100329391 316
66 3300025230 Ga0209563_100106 Ga0209563_10010674 316
67 3300025272 Ga0209455_1000495 Ga0209455_100049514 316
68 3300025924 Ga0207694_10073271 Ga0207694_100732712 316
69 3300026142 Ga0207698_10092395 Ga0207698_100923952 316
70 3300044656 Ga0466969_0023291 Ga0466969_0023291_832_1782 316
71 3300045049 Ga0466959_0002864 Ga0466959_0002864_8682_9632 316
72 3300061719 Ga0466962_0009607 Ga0466962_0009607_3041_3991 316
73 3300001979 JGI24740J21852_10000032 JGI24740J21852_1000003227 317
74 3300002739 JGI25158J39367_1001090 JGI25158J39367_10010907 317
75 3300002773 JGI25152J39213_1003458 JGI25152J39213_10034585 317
76 3300002773 JGI25152J39213_1007645 JGI25152J39213_10076452 317
77 3300002987 JGI25159J45721_1000895 JGI25159J45721_100089511 317
78 3300003215 JGI25153J46596_10011662 JGI25153J46596_100116622 317
79 3300003215 JGI25153J46596_10023032 JGI25153J46596_100230322 317
80 3300003316 rootH1_10003986 rootH1_100039865 317
81 3300003320 rootH2_10034773 rootH2_100347733 317
82 3300003320 rootH2_10206890 rootH2_102068902 317
83 3300003322 rootL2_10009173 rootL2_1000917328 317
84 3300003322 rootL2_10138931 rootL2_101389312 317
85 3300003323 rootH1_10072531 rootH1_100725311 317
86 3300003354 JGI25160J50197_1013065 JGI25160J50197_10130652 317
87 3300003374 JGI25161J50226_1000150 JGI25161J50226_100015050 317
88 3300003758 Ga0055532_1000202 Ga0055532_100020230 317
89 3300003760 Ga0055527_1000106 Ga0055527_100010640 317
90 3300003761 Ga0055535_1000210 Ga0055535_100021015 317
91 3300003761 Ga0055535_1000344 Ga0055535_10003449 317
92 3300003762 Ga0055542_1000166 Ga0055542_100016680 317
93 3300003762 Ga0055542_1000202 Ga0055542_100020226 317
94 3300003763 Ga0055529_1000181 Ga0055529_100018155 317
95 3300003771 Ga0055526_1002330 Ga0055526_100233011 317
96 3300003775 Ga0055524_1003057 Ga0055524_100305711 317
97 3300003790 Ga0055528_1003840 Ga0055528_10038403 317
98 3300003790 Ga0055528_1026279 Ga0055528_10262793 317
99 3300003792 Ga0055540_1004265 Ga0055540_10042659 317
100 3300003856 Ga0058692_1001318 Ga0058692_10013184 317
101 3300003856 Ga0058692_1016568 Ga0058692_10165682 317
102 3300004625 Ga0055543_1000074 Ga0055543_100007435 317
103 3300005262 Ga0065165_1010212 Ga0065165_10102126 317
104 3300005327 Ga0070658_10048785 Ga0070658_100487852 317
105 3300005548 Ga0070665_100015025 Ga0070665_1000150252 317
106 3300005563 Ga0068855_100013803 Ga0068855_1000138037 317
107 3300005578 Ga0068854_100004039 Ga0068854_1000040395 317
108 3300005614 Ga0068856_100016251 Ga0068856_1000162512 317
109 3300005616 Ga0068852_100370359 Ga0068852_1003703592 317
110 3300005937 Ga0081455_10129747 Ga0081455_101297472 317
111 3300006028 Ga0070717_10021308 Ga0070717_100213083 317
112 3300009093 Ga0105240_10070735 Ga0105240_100707353 317
113 3300009093 Ga0105240_10243185 Ga0105240_102431852 317
114 3300009174 Ga0105241_10002652 Ga0105241_1000265210 317
115 3300013104 Ga0157370_10127530 Ga0157370_101275302 317
116 3300013296 Ga0157374_10500538 Ga0157374_105005381 317
117 3300025208 Ga0209436_100011 Ga0209436_100011103 317
118 3300025228 Ga0209672_100067 Ga0209672_100067146 317
119 3300025228 Ga0209672_100803 Ga0209672_1008039 317
120 3300025229 Ga0209147_100012 Ga0209147_100012381 317
121 3300025242 Ga0209258_100030 Ga0209258_100030378 317
122 3300025242 Ga0209258_100286 Ga0209258_10028682 317
123 3300025245 Ga0207425_1003202 Ga0207425_10032025 317
124 3300025254 Ga0209148_1000022 Ga0209148_1000022246 317
125 3300025254 Ga0209148_1000135 Ga0209148_1000135142 317
126 3300025258 Ga0209129_1002525 Ga0209129_10025255 317
127 3300025258 Ga0209129_1005567 Ga0209129_10055673 317
128 3300025272 Ga0209455_1000024 Ga0209455_1000024377 317
129 3300025273 Ga0209673_1000021 Ga0209673_1000021198 317
130 3300025273 Ga0209673_1009774 Ga0209673_10097744 317
131 3300025284 Ga0209130_1000081 Ga0209130_1000081176 317
132 3300025295 Ga0209564_1000225 Ga0209564_100022570 317
133 3300025295 Ga0209564_1002877 Ga0209564_100287711 317
134 3300025297 Ga0209758_1003268 Ga0209758_100326814 317
135 3300025297 Ga0209758_1009853 Ga0209758_10098535 317
136 3300025299 Ga0209256_1005028 Ga0209256_100502810 317
137 3300025302 Ga0207426_1000008 Ga0207426_1000008657 317
138 3300025303 Ga0209051_1002199 Ga0209051_100219915 317
139 3300025904 Ga0207647_10029544 Ga0207647_100295444 317
140 3300025906 Ga0207699_10192878 Ga0207699_101928782 317
141 3300025911 Ga0207654_10032984 Ga0207654_100329842 317
142 3300025913 Ga0207695_10011795 Ga0207695_100117957 317
143 3300025913 Ga0207695_10072396 Ga0207695_100723963 317
144 3300025914 Ga0207671_10001887 Ga0207671_1000188720 317
145 3300025924 Ga0207694_10022655 Ga0207694_100226552 317
146 3300025929 Ga0207664_10000340 Ga0207664_100003405 317
147 3300025981 Ga0207640_10100537 Ga0207640_101005371 317
148 3300026142 Ga0207698_10086771 Ga0207698_100867712 317
149 3300027312 Ga0209371_1000128 Ga0209371_100012865 317
150 3300027312 Ga0209371_1001770 Ga0209371_10017708 317
151 3300027312 Ga0209371_1004380 Ga0209371_10043801 317
152 3300028379 Ga0268266_10333305 Ga0268266_103333052 317
153 3300030500 Ga0268256_1000152 Ga0268256_100015219 317
154 3300030500 Ga0268256_1002022 Ga0268256_10020225 317
155 3300030500 Ga0268256_1009637 Ga0268256_10096374 317
156 3300031456 Ga0307513_10007967 Ga0307513_100079671 317
157 3300031911 Ga0307412_10000083 Ga0307412_1000008333 317
158 3300037466 Ga0395898_0122381 Ga0395898_0122381_558_1517 317
159 3300037466 Ga0395898_0211542 Ga0395898_0211542_665_1618 317
160 3300037471 Ga0395905_0000314 Ga0395905_0000314_65482_66435 317
161 3300037471 Ga0395905_0001962 Ga0395905_0001962_11857_12810 317
162 3300044656 Ga0466969_0014772 Ga0466969_0014772_2118_3071 317
163 3300044656 Ga0466969_0026212 Ga0466969_0026212_1148_2101 317
164 3300044658 Ga0466972_0001274 Ga0466972_0001274_2351_3310 317
165 3300044672 Ga0466982_0000001 Ga0466982_0000001_476589_477560 317
166 3300044672 Ga0466982_0086761 Ga0466982_0086761_903_1865 317
167 3300044683 Ga0466965_0017177 Ga0466965_0017177_1209_2168 317
168 3300044684 Ga0466966_0004089 Ga0466966_0004089_3046_3999 317
169 3300044693 Ga0466961_0039880 Ga0466961_0039880_639_1592 317
170 3300044765 Ga0466970_0002539 Ga0466970_0002539_1834_2787 317
171 3300044842 Ga0466957_0207582 Ga0466957_0207582_37_990 317
172 3300045049 Ga0466959_0059594 Ga0466959_0059594_607_1560 317
173 3300045049 Ga0466959_0192786 Ga0466959_0192786_363_1316 317
174 3300045836 Ga0466958_0006439 Ga0466958_0006439_1997_2950 317
175 3300045836 Ga0466958_0075818 Ga0466958_0075818_103_1056 317
176 3300046462 Ga0495651_0038181 Ga0495651_0038181_214_1167 317
177 3300046463 Ga0495653_0132690 Ga0495653_0132690_624_1619 317
178 3300046516 Ga0495628_0008496 Ga0495628_0008496_7542_8495 317
179 3300046516 Ga0495628_0039081 Ga0495628_0039081_1678_2673 317
180 3300046522 Ga0495643_0019991 Ga0495643_0019991_432_1385 317
181 3300046524 Ga0495648_0037454 Ga0495648_0037454_1690_2685 317
182 3300046529 Ga0495652_0013048 Ga0495652_0013048_5306_6259 317
183 3300046529 Ga0495652_0180715 Ga0495652_0180715_138_1133 317
184 3300046679 Ga0495623_0217269 Ga0495623_0217269_66_1061 317
185 3300046690 Ga0495624_0075055 Ga0495624_0075055_56_1051 317
186 3300046809 Ga0495600_0014916 Ga0495600_0014916_1587_2540 317
187 3300047322 Ga0495680_0043334 Ga0495680_0043334_1908_2903 317
188 3300048920 Ga0496117_0168735 Ga0496117_0168735_236_1189 317
189 3300048922 Ga0496119_0000639 Ga0496119_0000639_22226_23179 317
190 3300048922 Ga0496119_0005725 Ga0496119_0005725_2489_3442 317
191 3300048923 Ga0496120_0170856 Ga0496120_0170856_111_1064 317
192 3300048925 Ga0496122_0066820 Ga0496122_0066820_1341_2294 317
193 3300048926 Ga0496123_0102161 Ga0496123_0102161_402_1355 317
194 3300048927 Ga0496124_0058037 Ga0496124_0058037_997_1950 317
195 3300048928 Ga0496125_0077357 Ga0496125_0077357_1266_2219 317
196 3300049568 Ga0501031_0009572 Ga0501031_0009572_5029_5982 317
197 3300049569 Ga0501032_0008911 Ga0501032_0008911_1720_2673 317
198 3300049569 Ga0501032_0153406 Ga0501032_0153406_521_1474 317
199 3300049572 Ga0501036_0018828 Ga0501036_0018828_2873_3826 317
200 3300049574 Ga0501038_0074181 Ga0501038_0074181_1670_2623 317
201 3300049578 Ga0501042_0012471 Ga0501042_0012471_521_1474 317
202 3300049579 Ga0501043_0019469 Ga0501043_0019469_1247_2200 317
203 3300049579 Ga0501043_0343961 Ga0501043_0343961_165_1118 317
204 3300049581 Ga0501047_0000023 Ga0501047_0000023_217592_218545 317
205 3300049581 Ga0501047_0005761 Ga0501047_0005761_2986_3939 317
206 3300049582 Ga0501048_0293391 Ga0501048_0293391_29_985 317
207 3300049586 Ga0501070_0314780 Ga0501070_0314780_292_1248 317
208 3300049671 Ga0501238_001722 Ga0501238_001722_806_1759 317
209 3300049822 Ga0501035_0000362 Ga0501035_0000362_31803_32756 317
210 3300049822 Ga0501035_0005301 Ga0501035_0005301_7859_8812 317
211 3300049822 Ga0501035_0007701 Ga0501035_0007701_7598_8551 317
212 3300049823 Ga0501044_0004767 Ga0501044_0004767_1454_2407 317
213 3300049823 Ga0501044_0017320 Ga0501044_0017320_3227_4180 317
214 3300049823 Ga0501044_0025316 Ga0501044_0025316_2008_2961 317
215 3300049823 Ga0501044_0032415 Ga0501044_0032415_351_1304 317
216 3300053160 Ga0500633_0001408 Ga0500633_0001408_793_1752 317
217 3300061719 Ga0466962_0014554 Ga0466962_0014554_12_965 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

10

301

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.851 4 301
6ow0-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with nad+ and peg 0.8463 6 307
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8414 5 301
3up8-assembly2.cif.gz_B crystal structure of a putative 2,5-diketo-d-gluconic acid reductase b 0.8385 8 301
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.8383 6 302
ID Description Score Start End Superfamily
af_Q7XCS4_50_365_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8732 1 307 3.20.20.100
af_Q0D8N4_49_369_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8689 6 306 3.20.20.100
af_P9WQA7_10_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8586 6 310 3.20.20.100
af_P9WQA7_10_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8559 6 310 3.20.20.100
af_A0A0R0FWW7_5_106_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8483 6 86 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A1G8NX47-F1-model_v4 Aldo/keto reductase family protein 0.9607 101 185 GO:0005829
GO:0016491
AF-A0A242BG72-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9498 51 314 GO:0005829
AF-A0A4Q2QTD6-F1-model_v4 Aldo/keto reductase 0.9481 112 313 GO:0005829
AF-A0A7K0DFR9-F1-model_v4 Aldo-keto reductase IolS (EC 1.1.1.-) 0.9467 43 317 GO:0004033
GO:0005737
AF-A0A2W5V726-F1-model_v4 Aldo/keto reductase 0.9417 84 317 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
86.57 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map