F329242

General Info

Members Datasets Scaffolds Average Seq Length
217 153 434 118

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0085283|Ga0501034_0085283_592_1029
Length 145
Sequence MTSDPPYRRAPDAHHPWQTAGMPMRQDCKFFESRTYANGETVRKCDLDLAPEAPWRCPDDCTAYTRRLADVNWKHGSLITPATPEEPPGLDDRGDEIASLLDEAEDIINAAGPRIMAEVDAERARASKPGVAGRLGRIFRRKPKG

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
78 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
79 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
80 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
81 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
84 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
85 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
86 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
87 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
88 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.59
Nodule 0
Rhizoplane 2.76
Rhizosphere 78.34
Stem 0
Stem Tuber 0
Unclassified 6.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0085283 3300049571 Bacteria 3160
2 Ga0070670_100810120 3300005331 Unclassified 846
3 Ga0070689_101408133 3300005340 Bacteria 630
4 Ga0070668_101937336 3300005347 Bacteria 543
5 Ga0070667_100188381 3300005367 Bacteria 1827
6 Ga0070714_101939650 3300005435 Bacteria 575
7 Ga0070700_100277215 3300005441 Bacteria 1214
8 Ga0070708_100073113 3300005445 Bacteria 3090
9 Ga0070681_10050274 3300005458 Bacteria 4160
10 Ga0070681_10082452 3300005458 Bacteria 3171
11 Ga0070706_100045922 3300005467 Bacteria 4033
12 Ga0070707_100806084 3300005468 Bacteria 903
13 Ga0070698_100346869 3300005471 Bacteria 1416
14 Ga0070679_101220994 3300005530 Bacteria 697
15 Ga0070686_100743357 3300005544 Bacteria 786
16 Ga0070696_100132010 3300005546 Bacteria 1818
17 Ga0070704_100322101 3300005549 Bacteria 1296
18 Ga0068855_100123345 3300005563 Bacteria 2964
19 Ga0068858_101144793 3300005842 Bacteria 764
20 Ga0068860_100062376 3300005843 Bacteria 3542
21 Ga0081455_10046020 3300005937 Bacteria 3791
22 Ga0075365_10427010 3300006038 Bacteria 936
23 Ga0075365_10458137 3300006038 Bacteria 901
24 Ga0075365_10472426 3300006038 Bacteria 886
25 Ga0075365_10786067 3300006038 Unclassified 672
26 Ga0075365_10806044 3300006038 Bacteria 663
27 Ga0075368_10288586 3300006042 Unclassified 706
28 Ga0075364_10001426 3300006051 Bacteria 12950
29 Ga0075364_10028306 3300006051 Bacteria 3586
30 Ga0075364_10125705 3300006051 Bacteria 1719
31 Ga0075364_10275681 3300006051 Unclassified 1144
32 Ga0075364_10371960 3300006051 Bacteria 975
33 Ga0075364_10520792 3300006051 Unclassified 813
34 Ga0075367_10053782 3300006178 Bacteria 2386
35 Ga0075367_10118920 3300006178 Bacteria 1627
36 Ga0075367_10251675 3300006178 Bacteria 1108
37 Ga0075367_10289683 3300006178 Bacteria 1030
38 Ga0075367_10798683 3300006178 Unclassified 601
39 Ga0075428_100515889 3300006844 Bacteria 1278
40 Ga0075428_102142153 3300006844 Bacteria 578
41 Ga0075430_100760589 3300006846 Bacteria 798
42 Ga0075429_100273086 3300006880 Bacteria 1481
43 Ga0105251_10484720 3300009011 Unclassified 576
44 Ga0111539_10035600 3300009094 Bacteria 6026
45 Ga0111539_10337751 3300009094 Bacteria 1754
46 Ga0105245_10000351 3300009098 Bacteria 42903
47 Ga0105245_10569579 3300009098 Bacteria 1156
48 Ga0105245_12299530 3300009098 Bacteria 593
49 Ga0114129_11442076 3300009147 Bacteria 848
50 Ga0105243_10091553 3300009148 Bacteria 2504
51 Ga0105243_11294977 3300009148 Bacteria 746
52 Ga0105241_11531384 3300009174 Bacteria 643
53 Ga0105242_10130522 3300009176 Bacteria 2168
54 Ga0105242_11590008 3300009176 Bacteria 687
55 Ga0105248_13409278 3300009177 Bacteria 505
56 Ga0105249_11835029 3300009553 Bacteria 679
57 Ga0157378_10681584 3300013297 Bacteria 1046
58 Ga0157375_10639807 3300013308 Bacteria 1220
59 Ga0157375_11611375 3300013308 Bacteria 768
60 Ga0157375_13184065 3300013308 Bacteria 547
61 Ga0213876_10018812 3300021384 Bacteria 3648
62 Ga0207653_10060042 3300025885 Bacteria 1280
63 Ga0207707_10044868 3300025912 Bacteria 3853
64 Ga0207707_10089497 3300025912 Bacteria 2690
65 Ga0207660_10734881 3300025917 Bacteria 805
66 Ga0207646_11153904 3300025922 Unclassified 680
67 Ga0207650_11459119 3300025925 Bacteria 582
68 Ga0207687_10003899 3300025927 Bacteria 10014
69 Ga0207687_10210045 3300025927 Bacteria 1527
70 Ga0207664_10593496 3300025929 Bacteria 994
71 Ga0207686_10094460 3300025934 Bacteria 1983
72 Ga0207709_10154597 3300025935 Bacteria 1593
73 Ga0207669_10641311 3300025937 Unclassified 868
74 Ga0207667_10387757 3300025949 Bacteria 1423
75 Ga0207712_11484002 3300025961 Bacteria 607
76 Ga0207668_10793660 3300025972 Bacteria 838
77 Ga0207648_11012556 3300026089 Unclassified 778
78 Ga0207675_101532863 3300026118 Bacteria 687
79 Ga0207428_10019241 3300027907 Bacteria 5822
80 Ga0268265_11478657 3300028380 Unclassified 683
81 Ga0268264_11842054 3300028381 Unclassified 615
82 Ga0316578_10062975 3300031728 Bacteria 2187
83 Ga0316577_10041581 3300031733 Bacteria 2572
84 Ga0307410_10012498 3300031852 Bacteria 4915
85 Ga0307407_10011205 3300031903 Bacteria 4257
86 Ga0307412_10479963 3300031911 Bacteria 1031
87 Ga0307412_11197539 3300031911 Bacteria 680
88 Ga0307412_11247804 3300031911 Bacteria 667
89 Ga0307409_100006585 3300031995 Bacteria 6848
90 Ga0307416_102871019 3300032002 Bacteria 576
91 Ga0307411_10106079 3300032005 Bacteria 1999
92 Ga0307415_100181166 3300032126 Bacteria 1653
93 Ga0307415_100305401 3300032126 Bacteria 1320
94 Ga0373956_0131720 3300035119 Bacteria 1171
95 Ga0373955_0268981 3300035172 Bacteria 1024
96 Ga0316574_0080273 3300035398 Bacteria 2070
97 Ga0316574_0557908 3300035398 Bacteria 710
98 Ga0373937_0043806 3300036401 Bacteria 4087
99 Ga0316582_0580675 3300036647 Bacteria 772
100 Ga0316584_0009539 3300036712 Bacteria 6743
101 Ga0316584_0125965 3300036712 Bacteria 1913
102 Ga0316584_0427079 3300036712 Bacteria 940
103 Ga0436365_0920219 3300039437 Bacteria 4514
104 Ga0436363_1599414 3300039450 Bacteria 536
105 Ga0439461_0122246 3300041410 Bacteria 652
106 Ga0439466_0151644 3300041411 Bacteria 710
107 Ga0451791_1164594 3300041451 Bacteria 734
108 Ga0451800_1679178 3300041459 Bacteria 534
109 Ga0451802_0498964 3300041460 Bacteria 614
110 Ga0451807_1427191 3300041486 Bacteria 521
111 Ga0451849_0193704 3300041505 Bacteria 605
112 Ga0451853_0922713 3300041512 Bacteria 1126
113 Ga0439457_055197 3300042014 Bacteria 895
114 Ga0450915_011546 3300042119 Bacteria 628
115 Ga0450902_003771 3300042137 Bacteria 2235
116 Ga0439446_0113511 3300042156 Bacteria 866
117 Ga0439434_0052164 3300042435 Unclassified 1269
118 Ga0450901_023232 3300042533 Bacteria 670
119 Ga0466963_0356061 3300044694 Bacteria 1031
120 Ga0466964_0149677 3300044706 Bacteria 1081
121 Ga0466957_0229330 3300044842 Bacteria 1229
122 Ga0466960_0496686 3300044901 Bacteria 714
123 Ga0466958_0751757 3300045836 Bacteria 635
124 Ga0466967_0173028 3300045976 Bacteria 2033
125 Ga0495629_0210889 3300046459 Bacteria 1342
126 Ga0495651_0022536 3300046462 Bacteria 4895
127 Ga0495653_0118657 3300046463 Bacteria 1889
128 Ga0495608_0022825 3300046511 Bacteria 4293
129 Ga0495618_0288810 3300046514 Bacteria 1021
130 Ga0495628_0419104 3300046516 Bacteria 976
131 Ga0495587_0156832 3300046536 Bacteria 1296
132 Ga0495667_0043091 3300046559 Bacteria 2991
133 Ga0495634_0385197 3300046642 Bacteria 835
134 Ga0495635_0454057 3300046663 Bacteria 847
135 Ga0495657_0005671 3300046675 Bacteria 9843
136 Ga0495623_0029993 3300046679 Bacteria 3500
137 Ga0495647_0298041 3300046681 Bacteria 726
138 Ga0495658_0081230 3300046683 Bacteria 1903
139 Ga0495600_0050821 3300046809 Bacteria 2705
140 Ga0495604_0065706 3300047317 Bacteria 2761
141 Ga0495676_0496429 3300047321 Bacteria 801
142 Ga0495680_0025632 3300047322 Bacteria 4876
143 Ga0495680_0132770 3300047322 Bacteria 1828
144 Ga0495675_0050042 3300047444 Bacteria 2656
145 Ga0495684_0171581 3300047471 Bacteria 1613
146 Ga0496104_0680579 3300048907 Bacteria 937
147 Ga0496110_0913430 3300048913 Bacteria 784
148 Ga0501031_0351128 3300049568 Bacteria 955
149 Ga0501032_0008949 3300049569 Bacteria 7281
150 Ga0501033_0006595 3300049570 Bacteria 9080
151 Ga0501034_0000724 3300049571 Bacteria 50070
152 Ga0501034_0016865 3300049571 Bacteria 7489
153 Ga0501034_0113739 3300049571 Bacteria 2696
154 Ga0501034_0152973 3300049571 Bacteria 2282
155 Ga0501034_0486520 3300049571 Bacteria 1149
156 Ga0501034_0654209 3300049571 Bacteria 952
157 Ga0501034_0875098 3300049571 Bacteria 787
158 Ga0501036_0234710 3300049572 Bacteria 1539
159 Ga0501036_0458946 3300049572 Bacteria 1061
160 Ga0501037_0015561 3300049573 Bacteria 5598
161 Ga0501038_0524131 3300049574 Bacteria 904
162 Ga0501038_0676041 3300049574 Bacteria 775
163 Ga0501039_0288686 3300049575 Bacteria 1290
164 Ga0501047_0233699 3300049581 Bacteria 1691
165 Ga0501047_0395854 3300049581 Bacteria 1215
166 Ga0501047_0936833 3300049581 Bacteria 679
167 Ga0501067_0436023 3300049583 Bacteria 731
168 Ga0501067_0576972 3300049583 Bacteria 630
169 Ga0501068_0296719 3300049584 Bacteria 1034
170 Ga0501069_0245426 3300049585 Bacteria 1044
171 Ga0501070_0008661 3300049586 Bacteria 8600
172 Ga0501070_0146473 3300049586 Bacteria 1949
173 Ga0501070_0827755 3300049586 Bacteria 725
174 Ga0501071_0073028 3300049587 Bacteria 2502
175 Ga0501071_0241098 3300049587 Bacteria 1363
176 Ga0501072_0078170 3300049588 Bacteria 2619
177 Ga0501074_0091601 3300049590 Bacteria 2177
178 Ga0501074_0424128 3300049590 Bacteria 943
179 Ga0501225_0075417 3300049705 Bacteria 963
180 Ga0501080_0053910 3300049742 Bacteria 3745
181 Ga0501080_0624957 3300049742 Bacteria 955
182 Ga0501080_0671934 3300049742 Bacteria 915
183 Ga0501083_0001248 3300049744 Bacteria 17270
184 Ga0501035_0289249 3300049822 Bacteria 1383
185 Ga0501044_0019480 3300049823 Bacteria 7257
186 Ga0501044_0291088 3300049823 Bacteria 1564
187 nmdc:mga03683_64397_c1 3300050489 Bacteria 1555
188 nmdc:mga00v17_1695_c1 3300050491 Bacteria 11464
189 nmdc:mga00v17_200338_c1 3300050491 Bacteria 1290
190 nmdc:mga00v17_266091_c1 3300050491 Bacteria 1112
191 nmdc:mga00v17_310881_c1 3300050491 Bacteria 1024
192 nmdc:mga0yw44_1100934_c1 3300050492 Bacteria 537
193 nmdc:mga0yw44_206553_c1 3300050492 Bacteria 1298
194 nmdc:mga0yw44_640445_c1 3300050492 Bacteria 722
195 nmdc:mga0yw44_86483_c1 3300050492 Bacteria 1974
196 nmdc:mga0yw44_972750_c1 3300050492 Bacteria 575
197 nmdc:mga0yw44_976030_c1 3300050492 Bacteria 574
198 nmdc:mga06z11_193293_c1 3300050494 Bacteria 1179
199 nmdc:mga06z11_199882_c1 3300050494 Bacteria 1160
200 nmdc:mga06z11_404376_c1 3300050494 Bacteria 822
201 nmdc:mga06z11_791187_c1 3300050494 Bacteria 578
202 nmdc:mga06z11_811250_c1 3300050494 Bacteria 570
203 nmdc:mga06z11_852666_c1 3300050494 Bacteria 555
204 nmdc:mga04h51_227324_c1 3300050495 Unclassified 741
205 nmdc:mga05p37_180335_c1 3300050507 Bacteria 2570
206 nmdc:mga09592_315361_c1 3300050508 Bacteria 1355
207 nmdc:mga0qj67_58967_c1 3300050509 Bacteria 3044
208 nmdc:mga06r32_121984_c1 3300050510 Bacteria 2572
209 nmdc:mga06r32_1602237_c1 3300050510 Bacteria 590
210 nmdc:mga08y16_19497_c1 3300050511 Bacteria 7151
211 nmdc:mga0rr50_1586869_c1 3300050513 Bacteria 552
212 Ga0495601_0337864 3300053077 Bacteria 980
213 Ga0495595_0031865 3300053084 Bacteria 2371
214 Ga0495619_0136796 3300053085 Bacteria 1685
215 Ga0500616_0001428 3300053153 Bacteria 22964
216 Ga0501082_0753721 3300060353 Bacteria 852
217 Ga0466962_0295218 3300061719 Bacteria 801
218 Ga0501034_0085283
219 Ga0070670_100810120
220 Ga0070689_101408133
221 Ga0070668_101937336
222 Ga0070667_100188381
223 Ga0070714_101939650
224 Ga0070700_100277215
225 Ga0070708_100073113
226 Ga0070681_10050274
227 Ga0070681_10082452
228 Ga0070706_100045922
229 Ga0070707_100806084
230 Ga0070698_100346869
231 Ga0070679_101220994
232 Ga0070686_100743357
233 Ga0070696_100132010
234 Ga0070704_100322101
235 Ga0068855_100123345
236 Ga0068858_101144793
237 Ga0068860_100062376
238 Ga0081455_10046020
239 Ga0075365_10427010
240 Ga0075365_10458137
241 Ga0075365_10472426
242 Ga0075365_10786067
243 Ga0075365_10806044
244 Ga0075368_10288586
245 Ga0075364_10001426
246 Ga0075364_10028306
247 Ga0075364_10125705
248 Ga0075364_10275681
249 Ga0075364_10371960
250 Ga0075364_10520792
251 Ga0075367_10053782
252 Ga0075367_10118920
253 Ga0075367_10251675
254 Ga0075367_10289683
255 Ga0075367_10798683
256 Ga0075428_100515889
257 Ga0075428_102142153
258 Ga0075430_100760589
259 Ga0075429_100273086
260 Ga0105251_10484720
261 Ga0111539_10035600
262 Ga0111539_10337751
263 Ga0105245_10000351
264 Ga0105245_10569579
265 Ga0105245_12299530
266 Ga0114129_11442076
267 Ga0105243_10091553
268 Ga0105243_11294977
269 Ga0105241_11531384
270 Ga0105242_10130522
271 Ga0105242_11590008
272 Ga0105248_13409278
273 Ga0105249_11835029
274 Ga0157378_10681584
275 Ga0157375_10639807
276 Ga0157375_11611375
277 Ga0157375_13184065
278 Ga0213876_10018812
279 Ga0207653_10060042
280 Ga0207707_10044868
281 Ga0207707_10089497
282 Ga0207660_10734881
283 Ga0207646_11153904
284 Ga0207650_11459119
285 Ga0207687_10003899
286 Ga0207687_10210045
287 Ga0207664_10593496
288 Ga0207686_10094460
289 Ga0207709_10154597
290 Ga0207669_10641311
291 Ga0207667_10387757
292 Ga0207712_11484002
293 Ga0207668_10793660
294 Ga0207648_11012556
295 Ga0207675_101532863
296 Ga0207428_10019241
297 Ga0268265_11478657
298 Ga0268264_11842054
299 Ga0316578_10062975
300 Ga0316577_10041581
301 Ga0307410_10012498
302 Ga0307407_10011205
303 Ga0307412_10479963
304 Ga0307412_11197539
305 Ga0307412_11247804
306 Ga0307409_100006585
307 Ga0307416_102871019
308 Ga0307411_10106079
309 Ga0307415_100181166
310 Ga0307415_100305401
311 Ga0373956_0131720
312 Ga0373955_0268981
313 Ga0316574_0080273
314 Ga0316574_0557908
315 Ga0373937_0043806
316 Ga0316582_0580675
317 Ga0316584_0009539
318 Ga0316584_0125965
319 Ga0316584_0427079
320 Ga0436365_0920219
321 Ga0436363_1599414
322 Ga0439461_0122246
323 Ga0439466_0151644
324 Ga0451791_1164594
325 Ga0451800_1679178
326 Ga0451802_0498964
327 Ga0451807_1427191
328 Ga0451849_0193704
329 Ga0451853_0922713
330 Ga0439457_055197
331 Ga0450915_011546
332 Ga0450902_003771
333 Ga0439446_0113511
334 Ga0439434_0052164
335 Ga0450901_023232
336 Ga0466963_0356061
337 Ga0466964_0149677
338 Ga0466957_0229330
339 Ga0466960_0496686
340 Ga0466958_0751757
341 Ga0466967_0173028
342 Ga0495629_0210889
343 Ga0495651_0022536
344 Ga0495653_0118657
345 Ga0495608_0022825
346 Ga0495618_0288810
347 Ga0495628_0419104
348 Ga0495587_0156832
349 Ga0495667_0043091
350 Ga0495634_0385197
351 Ga0495635_0454057
352 Ga0495657_0005671
353 Ga0495623_0029993
354 Ga0495647_0298041
355 Ga0495658_0081230
356 Ga0495600_0050821
357 Ga0495604_0065706
358 Ga0495676_0496429
359 Ga0495680_0025632
360 Ga0495680_0132770
361 Ga0495675_0050042
362 Ga0495684_0171581
363 Ga0496104_0680579
364 Ga0496110_0913430
365 Ga0501031_0351128
366 Ga0501032_0008949
367 Ga0501033_0006595
368 Ga0501034_0000724
369 Ga0501034_0016865
370 Ga0501034_0113739
371 Ga0501034_0152973
372 Ga0501034_0486520
373 Ga0501034_0654209
374 Ga0501034_0875098
375 Ga0501036_0234710
376 Ga0501036_0458946
377 Ga0501037_0015561
378 Ga0501038_0524131
379 Ga0501038_0676041
380 Ga0501039_0288686
381 Ga0501047_0233699
382 Ga0501047_0395854
383 Ga0501047_0936833
384 Ga0501067_0436023
385 Ga0501067_0576972
386 Ga0501068_0296719
387 Ga0501069_0245426
388 Ga0501070_0008661
389 Ga0501070_0146473
390 Ga0501070_0827755
391 Ga0501071_0073028
392 Ga0501071_0241098
393 Ga0501072_0078170
394 Ga0501074_0091601
395 Ga0501074_0424128
396 Ga0501225_0075417
397 Ga0501080_0053910
398 Ga0501080_0624957
399 Ga0501080_0671934
400 Ga0501083_0001248
401 Ga0501035_0289249
402 Ga0501044_0019480
403 Ga0501044_0291088
404 nmdc:mga03683_64397_c1
405 nmdc:mga00v17_1695_c1
406 nmdc:mga00v17_200338_c1
407 nmdc:mga00v17_266091_c1
408 nmdc:mga00v17_310881_c1
409 nmdc:mga0yw44_1100934_c1
410 nmdc:mga0yw44_206553_c1
411 nmdc:mga0yw44_640445_c1
412 nmdc:mga0yw44_86483_c1
413 nmdc:mga0yw44_972750_c1
414 nmdc:mga0yw44_976030_c1
415 nmdc:mga06z11_193293_c1
416 nmdc:mga06z11_199882_c1
417 nmdc:mga06z11_404376_c1
418 nmdc:mga06z11_791187_c1
419 nmdc:mga06z11_811250_c1
420 nmdc:mga06z11_852666_c1
421 nmdc:mga04h51_227324_c1
422 nmdc:mga05p37_180335_c1
423 nmdc:mga09592_315361_c1
424 nmdc:mga0qj67_58967_c1
425 nmdc:mga06r32_121984_c1
426 nmdc:mga06r32_1602237_c1
427 nmdc:mga08y16_19497_c1
428 nmdc:mga0rr50_1586869_c1
429 Ga0495601_0337864
430 Ga0495595_0031865
431 Ga0495619_0136796
432 Ga0500616_0001428
433 Ga0501082_0753721
434 Ga0466962_0295218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map