F328946

General Info

Members Datasets Scaffolds Average Seq Length
217 90 434 98

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101382819|Ga0307416_1013828192
Length 102
Sequence VPRPPRLSPDELSAALHGLPLWAGDGDGIRRTVELPSFRDAVAAIVAIADVAEEMDHHPDVDLRWRTLHLTLVSHSAGGVSELDLELARRIDALLPGSVQRL

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
60 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
61 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
62 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
65 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
66 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
67 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
70 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
71 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
72 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
73 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
74 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
87 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
90 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 1.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.15
Rhizosphere 95.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_101382819 3300032002 Bacteria 810
2 LJQas_1012857 3300000549 Bacteria 987
3 Ga0070658_10305993 3300005327 Bacteria 1356
4 Ga0070658_10378171 3300005327 Bacteria 1215
5 Ga0070683_100289886 3300005329 Bacteria 1557
6 Ga0070683_100607606 3300005329 Bacteria 1047
7 Ga0070680_100847821 3300005336 Bacteria 788
8 Ga0070660_100994667 3300005339 Bacteria 709
9 Ga0070692_11186798 3300005345 Bacteria 543
10 Ga0070675_101723009 3300005354 Bacteria 578
11 Ga0070659_100826856 3300005366 Bacteria 806
12 Ga0070714_100345889 3300005435 Bacteria 1396
13 Ga0070713_102233799 3300005436 Bacteria 530
14 Ga0070713_102492082 3300005436 Bacteria 500
15 Ga0070710_11113656 3300005437 Bacteria 580
16 Ga0070679_101345763 3300005530 Bacteria 660
17 Ga0070684_100845177 3300005535 Bacteria 857
18 Ga0070672_100694094 3300005543 Bacteria 891
19 Ga0070693_100177114 3300005547 Bacteria 1370
20 Ga0068852_102327166 3300005616 Bacteria 557
21 Ga0105245_12873431 3300009098 Bacteria 534
22 Ga0105243_10823343 3300009148 Bacteria 917
23 Ga0105242_11346643 3300009176 Bacteria 739
24 Ga0105237_11662932 3300009545 Bacteria 645
25 Ga0105238_10511908 3300009551 Bacteria 1202
26 Ga0105238_11203888 3300009551 Bacteria 782
27 Ga0105246_10990598 3300011119 Bacteria 760
28 Ga0157371_10770096 3300013102 Bacteria 724
29 Ga0157369_10054301 3300013105 Bacteria 4327
30 Ga0157369_10841319 3300013105 Bacteria 942
31 Ga0157372_10271495 3300013307 Bacteria 1971
32 Ga0206354_10082942 3300020081 Bacteria 4071
33 Ga0206354_11289963 3300020081 Bacteria 639
34 Ga0206353_11980302 3300020082 Bacteria 2162
35 Ga0207660_10350123 3300025917 Bacteria 1184
36 Ga0207657_10269042 3300025919 Bacteria 1355
37 Ga0207652_10849262 3300025921 Bacteria 808
38 Ga0207652_10956411 3300025921 Bacteria 754
39 Ga0207694_11426722 3300025924 Bacteria 585
40 Ga0207659_11223751 3300025926 Bacteria 645
41 Ga0207700_10549771 3300025928 Bacteria 1025
42 Ga0207690_10285344 3300025932 Bacteria 1287
43 Ga0207690_10360430 3300025932 Bacteria 1152
44 Ga0207709_10648706 3300025935 Bacteria 840
45 Ga0207661_10126900 3300025944 Bacteria 2180
46 Ga0207661_10457671 3300025944 Bacteria 1163
47 Ga0207702_11131365 3300026078 Bacteria 777
48 Ga0207698_10484836 3300026142 Bacteria 1200
49 Ga0307408_100244872 3300031548 Bacteria 1476
50 Ga0307408_100648800 3300031548 Bacteria 943
51 Ga0307408_101060143 3300031548 Bacteria 750
52 Ga0307408_102523127 3300031548 Bacteria 500
53 Ga0307405_10517438 3300031731 Bacteria 959
54 Ga0307405_10757621 3300031731 Bacteria 809
55 Ga0307405_10975284 3300031731 Bacteria 722
56 Ga0307405_10994113 3300031731 Bacteria 715
57 Ga0307405_11294351 3300031731 Bacteria 634
58 Ga0307413_10030486 3300031824 Bacteria 3030
59 Ga0307413_10048871 3300031824 Bacteria 2532
60 Ga0307413_10172449 3300031824 Bacteria 1533
61 Ga0307413_11620093 3300031824 Bacteria 575
62 Ga0307410_10121794 3300031852 Bacteria 1903
63 Ga0307410_10185746 3300031852 Bacteria 1577
64 Ga0307410_10192028 3300031852 Bacteria 1553
65 Ga0307410_11062851 3300031852 Bacteria 700
66 Ga0307406_10131659 3300031901 Bacteria 1757
67 Ga0307406_10252438 3300031901 Bacteria 1329
68 Ga0307406_10462785 3300031901 Bacteria 1020
69 Ga0307406_10569942 3300031901 Bacteria 929
70 Ga0307406_10591378 3300031901 Bacteria 914
71 Ga0307406_10658224 3300031901 Bacteria 870
72 Ga0307406_10801661 3300031901 Bacteria 795
73 Ga0307406_10809325 3300031901 Bacteria 791
74 Ga0307406_11333288 3300031901 Bacteria 627
75 Ga0307406_11582033 3300031901 Bacteria 578
76 Ga0307407_10003601 3300031903 Bacteria 6404
77 Ga0307407_10049614 3300031903 Bacteria 2396
78 Ga0307407_10196271 3300031903 Bacteria 1349
79 Ga0307407_10609018 3300031903 Bacteria 814
80 Ga0307407_10858365 3300031903 Bacteria 694
81 Ga0307412_10782051 3300031911 Bacteria 827
82 Ga0307412_11454285 3300031911 Bacteria 622
83 Ga0307412_11623888 3300031911 Bacteria 591
84 Ga0307409_100029095 3300031995 Bacteria 3948
85 Ga0307409_100090237 3300031995 Bacteria 2508
86 Ga0307409_100106798 3300031995 Bacteria 2337
87 Ga0307409_100211734 3300031995 Bacteria 1742
88 Ga0307409_100512406 3300031995 Bacteria 1170
89 Ga0307409_100568333 3300031995 Bacteria 1116
90 Ga0307409_100589224 3300031995 Bacteria 1097
91 Ga0307409_100685633 3300031995 Bacteria 1022
92 Ga0307409_100687341 3300031995 Bacteria 1021
93 Ga0307409_100762604 3300031995 Bacteria 972
94 Ga0307409_100784188 3300031995 Bacteria 959
95 Ga0307409_101343442 3300031995 Bacteria 740
96 Ga0307409_102280132 3300031995 Bacteria 571
97 Ga0307416_100158966 3300032002 Bacteria 2085
98 Ga0307416_100233631 3300032002 Bacteria 1775
99 Ga0307416_100307570 3300032002 Bacteria 1579
100 Ga0307416_100692555 3300032002 Bacteria 1107
101 Ga0307416_100864551 3300032002 Bacteria 1003
102 Ga0307416_101554885 3300032002 Bacteria 767
103 Ga0307416_101832163 3300032002 Bacteria 711
104 Ga0307416_102134659 3300032002 Bacteria 662
105 Ga0307416_102997436 3300032002 Bacteria 565
106 Ga0307416_103131541 3300032002 Bacteria 553
107 Ga0307414_10032070 3300032004 Bacteria 3455
108 Ga0307414_10097377 3300032004 Bacteria 2204
109 Ga0307414_11529559 3300032004 Bacteria 621
110 Ga0307411_10664151 3300032005 Bacteria 904
111 Ga0307411_10925950 3300032005 Bacteria 776
112 Ga0307411_10952233 3300032005 Bacteria 766
113 Ga0307411_11138326 3300032005 Bacteria 705
114 Ga0307411_11511462 3300032005 Bacteria 617
115 Ga0307411_11946886 3300032005 Bacteria 548
116 Ga0307415_100033368 3300032126 Bacteria 3341
117 Ga0307415_100051866 3300032126 Bacteria 2787
118 Ga0307415_100087217 3300032126 Bacteria 2248
119 Ga0307415_100182130 3300032126 Bacteria 1649
120 Ga0307415_100467807 3300032126 Bacteria 1094
121 Ga0307415_100549739 3300032126 Bacteria 1019
122 Ga0307415_100632445 3300032126 Bacteria 957
123 Ga0307415_101096119 3300032126 Bacteria 745
124 Ga0307415_102188210 3300032126 Bacteria 541
125 Ga0395899_0393349 3300037312 Bacteria 919
126 Ga0395900_0050349 3300037418 Bacteria 4290
127 Ga0395900_0478497 3300037418 Bacteria 1198
128 Ga0395898_0054543 3300037466 Bacteria 3900
129 Ga0395898_0145638 3300037466 Bacteria 2267
130 Ga0395898_0241633 3300037466 Bacteria 1722
131 Ga0395901_0034573 3300038443 Bacteria 5220
132 Ga0395901_0812121 3300038443 Bacteria 923
133 Ga0466972_0154381 3300044658 Bacteria 1079
134 Ga0466965_0091519 3300044683 Bacteria 1548
135 Ga0466965_0252608 3300044683 Bacteria 946
136 Ga0466965_0270139 3300044683 Bacteria 916
137 Ga0466966_0036275 3300044684 Bacteria 3184
138 Ga0466966_0063257 3300044684 Bacteria 2332
139 Ga0466966_0294277 3300044684 Bacteria 976
140 Ga0466966_0308050 3300044684 Bacteria 952
141 Ga0466966_0774188 3300044684 Bacteria 578
142 Ga0466961_0241798 3300044693 Bacteria 1109
143 Ga0466961_0296631 3300044693 Bacteria 988
144 Ga0466961_0355085 3300044693 Bacteria 892
145 Ga0466961_0417550 3300044693 Bacteria 813
146 Ga0466963_0089680 3300044694 Bacteria 2092
147 Ga0466963_0218517 3300044694 Bacteria 1334
148 Ga0466963_0295589 3300044694 Bacteria 1139
149 Ga0466963_0390312 3300044694 Bacteria 981
150 Ga0466963_0476558 3300044694 Bacteria 881
151 Ga0466963_0911862 3300044694 Bacteria 619
152 Ga0466963_1149547 3300044694 Bacteria 546
153 Ga0466964_0327123 3300044706 Bacteria 781
154 Ga0466971_0138093 3300044719 Bacteria 1134
155 Ga0466971_0409141 3300044719 Bacteria 662
156 Ga0466968_0131109 3300044735 Bacteria 1141
157 Ga0466970_0031633 3300044765 Bacteria 2795
158 Ga0466970_0079937 3300044765 Bacteria 1766
159 Ga0466970_0299437 3300044765 Bacteria 907
160 Ga0466970_0580696 3300044765 Bacteria 649
161 Ga0466957_0045504 3300044842 Bacteria 2662
162 Ga0466957_0345454 3300044842 Bacteria 1008
163 Ga0466957_0580393 3300044842 Bacteria 783
164 Ga0466957_0722023 3300044842 Bacteria 704
165 Ga0466960_0036963 3300044901 Bacteria 2289
166 Ga0466960_0096384 3300044901 Bacteria 1516
167 Ga0466960_0098290 3300044901 Bacteria 1503
168 Ga0466960_0112112 3300044901 Bacteria 1418
169 Ga0466960_0221044 3300044901 Bacteria 1042
170 Ga0466960_0359203 3300044901 Bacteria 832
171 Ga0466960_0386923 3300044901 Bacteria 803
172 Ga0466960_0552580 3300044901 Bacteria 679
173 Ga0466959_0019578 3300045049 Bacteria 4978
174 Ga0466959_0078994 3300045049 Bacteria 2373
175 Ga0466959_0097577 3300045049 Bacteria 2106
176 Ga0466959_0257161 3300045049 Bacteria 1203
177 Ga0466958_0107991 3300045836 Bacteria 1736
178 Ga0466958_0147858 3300045836 Bacteria 1481
179 Ga0466958_0221956 3300045836 Bacteria 1206
180 Ga0466958_0481746 3300045836 Bacteria 804
181 Ga0466958_0644595 3300045836 Bacteria 689
182 Ga0466958_0865733 3300045836 Bacteria 589
183 Ga0466967_0001082 3300045976 Bacteria 15069
184 Ga0466967_0009600 3300045976 Bacteria 7191
185 Ga0466967_0118839 3300045976 Bacteria 2439
186 Ga0466967_0181892 3300045976 Bacteria 1983
187 Ga0466967_0327951 3300045976 Bacteria 1478
188 Ga0466967_0733176 3300045976 Bacteria 980
189 Ga0466967_0813075 3300045976 Bacteria 928
190 Ga0466967_1695995 3300045976 Bacteria 629
191 Ga0466967_2521698 3300045976 Bacteria 509
192 Ga0495631_0037986 3300046518 Bacteria 2143
193 Ga0496100_0402450 3300048903 Bacteria 1043
194 Ga0496100_1049111 3300048903 Bacteria 642
195 Ga0496101_0544213 3300048904 Bacteria 918
196 Ga0496104_0303564 3300048907 Bacteria 1509
197 Ga0496110_1401361 3300048913 Bacteria 608
198 Ga0496111_0473659 3300048914 Bacteria 923
199 Ga0496112_1169557 3300048915 Bacteria 686
200 Ga0496113_1016244 3300048916 Bacteria 653
201 Ga0496115_1302920 3300048918 Bacteria 541
202 Ga0501318_002620 3300049534 Bacteria 1579
203 Ga0501036_1318118 3300049572 Bacteria 586
204 Ga0501040_0838868 3300049576 Bacteria 665
205 Ga0501041_0702042 3300049577 Bacteria 647
206 Ga0501042_0718719 3300049578 Bacteria 726
207 Ga0501072_1576099 3300049588 Bacteria 506
208 Ga0501075_0184210 3300049591 Bacteria 1593
209 Ga0501076_1259341 3300049592 Bacteria 608
210 Ga0501077_0144875 3300049593 Bacteria 1507
211 Ga0501239_082419 3300049672 Bacteria 518
212 Ga0501045_0455067 3300049824 Bacteria 951
213 Ga0501082_0512357 3300060353 Bacteria 1049
214 Ga0466962_0016415 3300061719 Bacteria 3571
215 Ga0466962_0019848 3300061719 Bacteria 3230
216 Ga0466962_0246341 3300061719 Bacteria 878
217 Ga0466962_0542317 3300061719 Bacteria 590
218 Ga0307416_101382819
219 LJQas_1012857
220 Ga0070658_10305993
221 Ga0070658_10378171
222 Ga0070683_100289886
223 Ga0070683_100607606
224 Ga0070680_100847821
225 Ga0070660_100994667
226 Ga0070692_11186798
227 Ga0070675_101723009
228 Ga0070659_100826856
229 Ga0070714_100345889
230 Ga0070713_102233799
231 Ga0070713_102492082
232 Ga0070710_11113656
233 Ga0070679_101345763
234 Ga0070684_100845177
235 Ga0070672_100694094
236 Ga0070693_100177114
237 Ga0068852_102327166
238 Ga0105245_12873431
239 Ga0105243_10823343
240 Ga0105242_11346643
241 Ga0105237_11662932
242 Ga0105238_10511908
243 Ga0105238_11203888
244 Ga0105246_10990598
245 Ga0157371_10770096
246 Ga0157369_10054301
247 Ga0157369_10841319
248 Ga0157372_10271495
249 Ga0206354_10082942
250 Ga0206354_11289963
251 Ga0206353_11980302
252 Ga0207660_10350123
253 Ga0207657_10269042
254 Ga0207652_10849262
255 Ga0207652_10956411
256 Ga0207694_11426722
257 Ga0207659_11223751
258 Ga0207700_10549771
259 Ga0207690_10285344
260 Ga0207690_10360430
261 Ga0207709_10648706
262 Ga0207661_10126900
263 Ga0207661_10457671
264 Ga0207702_11131365
265 Ga0207698_10484836
266 Ga0307408_100244872
267 Ga0307408_100648800
268 Ga0307408_101060143
269 Ga0307408_102523127
270 Ga0307405_10517438
271 Ga0307405_10757621
272 Ga0307405_10975284
273 Ga0307405_10994113
274 Ga0307405_11294351
275 Ga0307413_10030486
276 Ga0307413_10048871
277 Ga0307413_10172449
278 Ga0307413_11620093
279 Ga0307410_10121794
280 Ga0307410_10185746
281 Ga0307410_10192028
282 Ga0307410_11062851
283 Ga0307406_10131659
284 Ga0307406_10252438
285 Ga0307406_10462785
286 Ga0307406_10569942
287 Ga0307406_10591378
288 Ga0307406_10658224
289 Ga0307406_10801661
290 Ga0307406_10809325
291 Ga0307406_11333288
292 Ga0307406_11582033
293 Ga0307407_10003601
294 Ga0307407_10049614
295 Ga0307407_10196271
296 Ga0307407_10609018
297 Ga0307407_10858365
298 Ga0307412_10782051
299 Ga0307412_11454285
300 Ga0307412_11623888
301 Ga0307409_100029095
302 Ga0307409_100090237
303 Ga0307409_100106798
304 Ga0307409_100211734
305 Ga0307409_100512406
306 Ga0307409_100568333
307 Ga0307409_100589224
308 Ga0307409_100685633
309 Ga0307409_100687341
310 Ga0307409_100762604
311 Ga0307409_100784188
312 Ga0307409_101343442
313 Ga0307409_102280132
314 Ga0307416_100158966
315 Ga0307416_100233631
316 Ga0307416_100307570
317 Ga0307416_100692555
318 Ga0307416_100864551
319 Ga0307416_101554885
320 Ga0307416_101832163
321 Ga0307416_102134659
322 Ga0307416_102997436
323 Ga0307416_103131541
324 Ga0307414_10032070
325 Ga0307414_10097377
326 Ga0307414_11529559
327 Ga0307411_10664151
328 Ga0307411_10925950
329 Ga0307411_10952233
330 Ga0307411_11138326
331 Ga0307411_11511462
332 Ga0307411_11946886
333 Ga0307415_100033368
334 Ga0307415_100051866
335 Ga0307415_100087217
336 Ga0307415_100182130
337 Ga0307415_100467807
338 Ga0307415_100549739
339 Ga0307415_100632445
340 Ga0307415_101096119
341 Ga0307415_102188210
342 Ga0395899_0393349
343 Ga0395900_0050349
344 Ga0395900_0478497
345 Ga0395898_0054543
346 Ga0395898_0145638
347 Ga0395898_0241633
348 Ga0395901_0034573
349 Ga0395901_0812121
350 Ga0466972_0154381
351 Ga0466965_0091519
352 Ga0466965_0252608
353 Ga0466965_0270139
354 Ga0466966_0036275
355 Ga0466966_0063257
356 Ga0466966_0294277
357 Ga0466966_0308050
358 Ga0466966_0774188
359 Ga0466961_0241798
360 Ga0466961_0296631
361 Ga0466961_0355085
362 Ga0466961_0417550
363 Ga0466963_0089680
364 Ga0466963_0218517
365 Ga0466963_0295589
366 Ga0466963_0390312
367 Ga0466963_0476558
368 Ga0466963_0911862
369 Ga0466963_1149547
370 Ga0466964_0327123
371 Ga0466971_0138093
372 Ga0466971_0409141
373 Ga0466968_0131109
374 Ga0466970_0031633
375 Ga0466970_0079937
376 Ga0466970_0299437
377 Ga0466970_0580696
378 Ga0466957_0045504
379 Ga0466957_0345454
380 Ga0466957_0580393
381 Ga0466957_0722023
382 Ga0466960_0036963
383 Ga0466960_0096384
384 Ga0466960_0098290
385 Ga0466960_0112112
386 Ga0466960_0221044
387 Ga0466960_0359203
388 Ga0466960_0386923
389 Ga0466960_0552580
390 Ga0466959_0019578
391 Ga0466959_0078994
392 Ga0466959_0097577
393 Ga0466959_0257161
394 Ga0466958_0107991
395 Ga0466958_0147858
396 Ga0466958_0221956
397 Ga0466958_0481746
398 Ga0466958_0644595
399 Ga0466958_0865733
400 Ga0466967_0001082
401 Ga0466967_0009600
402 Ga0466967_0118839
403 Ga0466967_0181892
404 Ga0466967_0327951
405 Ga0466967_0733176
406 Ga0466967_0813075
407 Ga0466967_1695995
408 Ga0466967_2521698
409 Ga0495631_0037986
410 Ga0496100_0402450
411 Ga0496100_1049111
412 Ga0496101_0544213
413 Ga0496104_0303564
414 Ga0496110_1401361
415 Ga0496111_0473659
416 Ga0496112_1169557
417 Ga0496113_1016244
418 Ga0496115_1302920
419 Ga0501318_002620
420 Ga0501036_1318118
421 Ga0501040_0838868
422 Ga0501041_0702042
423 Ga0501042_0718719
424 Ga0501072_1576099
425 Ga0501075_0184210
426 Ga0501076_1259341
427 Ga0501077_0144875
428 Ga0501239_082419
429 Ga0501045_0455067
430 Ga0501082_0512357
431 Ga0466962_0016415
432 Ga0466962_0019848
433 Ga0466962_0246341
434 Ga0466962_0542317

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

5

94

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.9623 6 94
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.9588 6 94
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.952 22 94
1uso-assembly1.cif.gz_A dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.9431 28 95
3hxa-assembly1.cif.gz_D crystal structure of dcoh1thr51ser 0.9259 3 94
ID Description Score Start End Superfamily
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9664 7 96 3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9593 7 94 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9588 6 94 3.30.1360.20
af_Q5ACY8_6_110_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9448 5 94 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9261 7 96 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A4U3CE15-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) 1.001 1 96 GO:0006729
GO:0008124
AF-A0A4V2Z2J7-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) 1 6 94 GO:0006729
GO:0008124
AF-A0A6F8YM11-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) 1 16 94 GO:0006729
GO:0008124
AF-A0A2P8DX73-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) 0.9987 6 94 GO:0006729
GO:0008124
AF-A0A1H8SCH8-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) 0.9918 1 96 GO:0006729
GO:0008124

Map