F328873

General Info

Members Datasets Scaffolds Average Seq Length
217 110 434 235

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10338073|Ga0207648_103380732
Length 265
Sequence MSRDAVSRAERPATAAPPRPADPLPAPVDRRLGSTVLGLWPVVVAFGAFVAAWKVASILAGLAFILPAPEVVAARFVAAWVDGTMTPHVWTTLVEVVLGFAAGAGVGLVAGYAIARSRLVERFVSPYLVAAQAVPILVLAPLLVVWFGSGLLSKAVICSLIVFFPVAIATMVGIRSVDPRLLELGRSLRATRRQILTTLEIPAALPNIFGGLRVANSGLAVLINLARGSLFDIPLMFATLLTIALVGIALYLAVVVAERRLVGAR

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
59 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
68 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
69 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
70 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
71 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
72 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
88 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
89 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
90 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
91 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
92 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
93 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
105 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
106 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
107 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
108 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
110 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.23
Rhizosphere 94.93
Stem 0
Stem Tuber 0
Unclassified 7.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10338073 3300026089 Bacteria 1355
2 rootL2_10039048 3300003322 Bacteria 4116
3 rootH1_10194356 3300003323 Bacteria 3939
4 Ga0068868_100037001 3300005338 Bacteria 3781
5 Ga0070689_100839489 3300005340 Bacteria 810
6 Ga0070673_100902669 3300005364 Bacteria 819
7 Ga0070713_100564529 3300005436 Bacteria 1079
8 Ga0070700_100159295 3300005441 Bacteria 1552
9 Ga0070708_100807623 3300005445 Bacteria 882
10 Ga0070681_10061764 3300005458 Bacteria 3721
11 Ga0070706_100075047 3300005467 Bacteria 3129
12 Ga0070707_100125115 3300005468 Bacteria 2497
13 Ga0070707_100425102 3300005468 Bacteria 1289
14 Ga0070698_100007498 3300005471 Bacteria 11803
15 Ga0070698_100021323 3300005471 Bacteria 6787
16 Ga0070698_100033426 3300005471 Bacteria 5327
17 Ga0070698_100220284 3300005471 Bacteria 1831
18 Ga0070699_100020706 3300005518 Bacteria 5672
19 Ga0070699_100200006 3300005518 Bacteria 1776
20 Ga0070679_100280841 3300005530 Bacteria 1618
21 Ga0070697_100029158 3300005536 Bacteria 4423
22 Ga0070696_100010121 3300005546 Bacteria 6313
23 Ga0070696_100208284 3300005546 Bacteria 1463
24 Ga0068864_100385048 3300005618 Bacteria 1330
25 Ga0081539_10003597 3300005985 Bacteria 18751
26 Ga0081539_10006414 3300005985 Bacteria 11298
27 Ga0097621_100573222 3300006237 Bacteria 1029
28 Ga0075433_10093002 3300006852 Bacteria 2668
29 Ga0075433_10200527 3300006852 Bacteria 1774
30 Ga0075435_100147602 3300007076 Bacteria 1976
31 Ga0075435_100167556 3300007076 Bacteria 1852
32 Ga0111539_10364273 3300009094 Unclassified 1683
33 Ga0114129_10309724 3300009147 Bacteria 2102
34 Ga0105249_10281435 3300009553 Bacteria 1661
35 Ga0105246_10280795 3300011119 Bacteria 1336
36 Ga0157378_10130704 3300013297 Unclassified 2324
37 Ga0163163_10168135 3300014325 Bacteria 2239
38 Ga0163163_10185636 3300014325 Bacteria 2127
39 Ga0163163_10209861 3300014325 Bacteria 1996
40 Ga0163163_10272652 3300014325 Bacteria 1743
41 Ga0157380_10414568 3300014326 Unclassified 1282
42 Ga0157380_10635228 3300014326 Bacteria 1062
43 Ga0182008_10101955 3300014497 Bacteria 1419
44 Ga0157379_10363439 3300014968 Bacteria 1327
45 Ga0157376_10503093 3300014969 Bacteria 1191
46 Ga0207684_10075463 3300025910 Bacteria 2865
47 Ga0207652_10210196 3300025921 Bacteria 1752
48 Ga0207646_10025897 3300025922 Bacteria 5363
49 Ga0207646_10107776 3300025922 Bacteria 2499
50 Ga0207646_10275371 3300025922 Bacteria 1521
51 Ga0207706_10444113 3300025933 Bacteria 1122
52 Ga0207689_10144648 3300025942 Bacteria 1959
53 Ga0207689_10317595 3300025942 Bacteria 1292
54 Ga0207708_10357776 3300026075 Bacteria 1199
55 Ga0207683_10091397 3300026121 Bacteria 2712
56 Ga0209999_1004066 3300027543 Bacteria 2629
57 Ga0210002_1017105 3300027617 Bacteria 1152
58 Ga0209971_1016309 3300027682 Bacteria 1762
59 Ga0209966_1004942 3300027695 Bacteria 2277
60 Ga0209998_10000800 3300027717 Bacteria 8109
61 Ga0209974_10007044 3300027876 Bacteria 3889
62 Ga0265319_1006421 3300028563 Bacteria 5447
63 Ga0265334_10056248 3300028573 Bacteria 1494
64 Ga0265318_10003696 3300028577 Bacteria 7643
65 Ga0265324_10016611 3300029957 Bacteria 2683
66 Ga0265331_10022486 3300031250 Bacteria 3217
67 Ga0265314_10110879 3300031711 Bacteria 1744
68 Ga0265314_10233010 3300031711 Bacteria 1067
69 Ga0307405_10081194 3300031731 Bacteria 2119
70 Ga0307405_10092937 3300031731 Bacteria 2003
71 Ga0307413_10143716 3300031824 Bacteria 1652
72 Ga0307406_10374500 3300031901 Bacteria 1120
73 Ga0307416_100005051 3300032002 Bacteria 8042
74 Ga0307416_100345904 3300032002 Bacteria 1502
75 Ga0307415_100092416 3300032126 Bacteria 2194
76 Ga0307415_100254051 3300032126 Bacteria 1430
77 Ga0395901_0570968 3300038443 Bacteria 1144
78 Ga0451793_0332728 3300041452 Bacteria 919
79 Ga0451839_1319808 3300041496 Bacteria 887
80 Ga0451853_3782085 3300041512 Bacteria 2009
81 Ga0450920_021717 3300042122 Bacteria 1242
82 Ga0451577_0008264 3300042876 Bacteria 10138
83 Ga0451577_0415228 3300042876 Unclassified 1222
84 Ga0495592_0426515 3300046454 Bacteria 835
85 Ga0495651_0333481 3300046462 Bacteria 1007
86 Ga0495653_0161687 3300046463 Bacteria 1554
87 Ga0495594_0191270 3300046499 Unclassified 1166
88 Ga0495652_0563085 3300046529 Bacteria 782
89 Ga0495599_0174339 3300046678 Bacteria 1327
90 Ga0495647_0148753 3300046681 Bacteria 1003
91 Ga0495604_0452345 3300047317 Bacteria 839
92 Ga0496107_0193906 3300048910 Bacteria 1510
93 Ga0496107_0318876 3300048910 Bacteria 1157
94 Ga0496109_0225223 3300048912 Bacteria 1764
95 Ga0496109_0258221 3300048912 Bacteria 1641
96 Ga0496111_0091406 3300048914 Bacteria 2230
97 Ga0496112_0536542 3300048915 Bacteria 1104
98 Ga0501031_0066453 3300049568 Bacteria 2350
99 Ga0501031_0088267 3300049568 Bacteria 2022
100 Ga0501031_0153378 3300049568 Bacteria 1506
101 Ga0501031_0173176 3300049568 Bacteria 1410
102 Ga0501031_0211452 3300049568 Unclassified 1264
103 Ga0501036_0004700 3300049572 Bacteria 11026
104 Ga0501038_0084925 3300049574 Bacteria 2663
105 Ga0501038_0257377 3300049574 Bacteria 1381
106 Ga0501038_0394385 3300049574 Bacteria 1072
107 Ga0501038_0412876 3300049574 Unclassified 1043
108 Ga0501039_0016293 3300049575 Bacteria 5694
109 Ga0501039_0041687 3300049575 Bacteria 3547
110 Ga0501039_0102899 3300049575 Bacteria 2229
111 Ga0501040_0007441 3300049576 Bacteria 7091
112 Ga0501040_0181292 3300049576 Bacteria 1493
113 Ga0501040_0215017 3300049576 Bacteria 1367
114 Ga0501040_0434003 3300049576 Unclassified 945
115 Ga0501040_0489864 3300049576 Bacteria 886
116 Ga0501041_0078957 3300049577 Bacteria 2026
117 Ga0501041_0170611 3300049577 Bacteria 1361
118 Ga0501042_0011304 3300049578 Bacteria 6018
119 Ga0501042_0042682 3300049578 Bacteria 3229
120 Ga0501042_0050721 3300049578 Bacteria 2960
121 Ga0501042_0085608 3300049578 Bacteria 2260
122 Ga0501042_0088055 3300049578 Bacteria 2228
123 Ga0501042_0349528 3300049578 Unclassified 1069
124 Ga0501043_0439570 3300049579 Bacteria 982
125 Ga0501046_0074144 3300049580 Bacteria 2641
126 Ga0501046_0176741 3300049580 Bacteria 1599
127 Ga0501046_0192637 3300049580 Bacteria 1520
128 Ga0501046_0209288 3300049580 Bacteria 1448
129 Ga0501048_0033704 3300049582 Bacteria 3698
130 Ga0501048_0058289 3300049582 Bacteria 2737
131 Ga0501048_0096250 3300049582 Bacteria 2088
132 Ga0501067_0003145 3300049583 Bacteria 9114
133 Ga0501067_0095738 3300049583 Unclassified 1648
134 Ga0501068_0049851 3300049584 Bacteria 2530
135 Ga0501068_0052213 3300049584 Bacteria 2473
136 Ga0501068_0086173 3300049584 Unclassified 1934
137 Ga0501068_0090542 3300049584 Bacteria 1887
138 Ga0501068_0193480 3300049584 Unclassified 1289
139 Ga0501069_0007787 3300049585 Bacteria 5624
140 Ga0501069_0434546 3300049585 Bacteria 779
141 Ga0501070_0131296 3300049586 Bacteria 2069
142 Ga0501070_0381817 3300049586 Unclassified 1141
143 Ga0501071_0007765 3300049587 Bacteria 7075
144 Ga0501071_0038206 3300049587 Bacteria 3430
145 Ga0501071_0054218 3300049587 Bacteria 2893
146 Ga0501071_0063331 3300049587 Bacteria 2681
147 Ga0501071_0158817 3300049587 Bacteria 1689
148 Ga0501072_0003834 3300049588 Bacteria 11359
149 Ga0501072_0099240 3300049588 Bacteria 2315
150 Ga0501072_0122440 3300049588 Bacteria 2072
151 Ga0501073_0249916 3300049589 Bacteria 1224
152 Ga0501074_0113485 3300049590 Bacteria 1939
153 Ga0501074_0121229 3300049590 Bacteria 1870
154 Ga0501074_0166864 3300049590 Bacteria 1572
155 Ga0501074_0174750 3300049590 Bacteria 1533
156 Ga0501074_0238993 3300049590 Bacteria 1292
157 Ga0501074_0432200 3300049590 Bacteria 934
158 Ga0501075_0024763 3300049591 Bacteria 4406
159 Ga0501075_0151490 3300049591 Bacteria 1768
160 Ga0501075_0178678 3300049591 Bacteria 1620
161 Ga0501075_0270888 3300049591 Unclassified 1294
162 Ga0501075_0350724 3300049591 Bacteria 1124
163 Ga0501076_0073384 3300049592 Bacteria 2740
164 Ga0501076_0108059 3300049592 Bacteria 2247
165 Ga0501076_0114161 3300049592 Bacteria 2185
166 Ga0501076_0134566 3300049592 Bacteria 2006
167 Ga0501076_0269907 3300049592 Bacteria 1393
168 Ga0501077_0036502 3300049593 Bacteria 3131
169 Ga0501077_0352875 3300049593 Unclassified 939
170 Ga0501079_0005897 3300049741 Bacteria 9172
171 Ga0501079_0010632 3300049741 Bacteria 7004
172 Ga0501079_0028620 3300049741 Bacteria 4276
173 Ga0501079_0117728 3300049741 Bacteria 2065
174 Ga0501079_0128434 3300049741 Bacteria 1972
175 Ga0501080_0026278 3300049742 Bacteria 5410
176 Ga0501080_0061104 3300049742 Bacteria 3508
177 Ga0501080_0409965 3300049742 Unclassified 1218
178 Ga0501080_0593487 3300049742 Bacteria 984
179 Ga0501081_0014319 3300049743 Bacteria 5228
180 Ga0501081_0030682 3300049743 Bacteria 3640
181 Ga0501081_0061351 3300049743 Bacteria 2607
182 Ga0501081_0085859 3300049743 Bacteria 2209
183 Ga0501081_0102303 3300049743 Bacteria 2026
184 Ga0501081_0149033 3300049743 Bacteria 1680
185 Ga0501081_0284398 3300049743 Bacteria 1211
186 Ga0501035_0021079 3300049822 Bacteria 5992
187 Ga0501035_0229606 3300049822 Bacteria 1582
188 Ga0501044_0701957 3300049823 Bacteria 897
189 Ga0501045_0037204 3300049824 Bacteria 3537
190 Ga0501045_0043211 3300049824 Bacteria 3281
191 Ga0501045_0069604 3300049824 Bacteria 2587
192 Ga0501045_0109899 3300049824 Bacteria 2044
193 Ga0501045_0198421 3300049824 Bacteria 1495
194 nmdc:mga05p37_186358_c1 3300050507 Bacteria 2523
195 nmdc:mga05p37_224573_c1 3300050507 Bacteria 2265
196 nmdc:mga0n895_39978_c1 3300050512 Bacteria 4555
197 nmdc:mga0rr50_102979_c1 3300050513 Bacteria 2246
198 nmdc:mga0rr50_140220_c1 3300050513 Bacteria 1944
199 nmdc:mga0a205_193798_c1 3300050515 Bacteria 1923
200 nmdc:mga0a205_280120_c1 3300050515 Bacteria 1543
201 Ga0495595_0043584 3300053084 Bacteria 2059
202 Ga0495619_0045730 3300053085 Bacteria 2876
203 Ga0495619_0246144 3300053085 Bacteria 1239
204 Ga0501084_0120947 3300054114 Unclassified 2202
205 Ga0501084_0222436 3300054114 Bacteria 1593
206 Ga0501082_0016143 3300060353 Bacteria 6425
207 Ga0501082_0142602 3300060353 Bacteria 2079
208 Ga0501082_0163647 3300060353 Bacteria 1933
209 Ga0501082_0272028 3300060353 Bacteria 1474
210 Ga0501082_0362187 3300060353 Bacteria 1265
211 Ga0530510_0015328 3300061734 Bacteria 5415
212 Ga0530510_0035444 3300061734 Bacteria 3596
213 Ga0530510_0048777 3300061734 Bacteria 3060
214 Ga0530510_0081988 3300061734 Bacteria 2349
215 Ga0530510_0124609 3300061734 Bacteria 1893
216 Ga0530510_0152152 3300061734 Bacteria 1709
217 Ga0530510_0401206 3300061734 Bacteria 1033
218 Ga0207648_10338073
219 rootL2_10039048
220 rootH1_10194356
221 Ga0068868_100037001
222 Ga0070689_100839489
223 Ga0070673_100902669
224 Ga0070713_100564529
225 Ga0070700_100159295
226 Ga0070708_100807623
227 Ga0070681_10061764
228 Ga0070706_100075047
229 Ga0070707_100125115
230 Ga0070707_100425102
231 Ga0070698_100007498
232 Ga0070698_100021323
233 Ga0070698_100033426
234 Ga0070698_100220284
235 Ga0070699_100020706
236 Ga0070699_100200006
237 Ga0070679_100280841
238 Ga0070697_100029158
239 Ga0070696_100010121
240 Ga0070696_100208284
241 Ga0068864_100385048
242 Ga0081539_10003597
243 Ga0081539_10006414
244 Ga0097621_100573222
245 Ga0075433_10093002
246 Ga0075433_10200527
247 Ga0075435_100147602
248 Ga0075435_100167556
249 Ga0111539_10364273
250 Ga0114129_10309724
251 Ga0105249_10281435
252 Ga0105246_10280795
253 Ga0157378_10130704
254 Ga0163163_10168135
255 Ga0163163_10185636
256 Ga0163163_10209861
257 Ga0163163_10272652
258 Ga0157380_10414568
259 Ga0157380_10635228
260 Ga0182008_10101955
261 Ga0157379_10363439
262 Ga0157376_10503093
263 Ga0207684_10075463
264 Ga0207652_10210196
265 Ga0207646_10025897
266 Ga0207646_10107776
267 Ga0207646_10275371
268 Ga0207706_10444113
269 Ga0207689_10144648
270 Ga0207689_10317595
271 Ga0207708_10357776
272 Ga0207683_10091397
273 Ga0209999_1004066
274 Ga0210002_1017105
275 Ga0209971_1016309
276 Ga0209966_1004942
277 Ga0209998_10000800
278 Ga0209974_10007044
279 Ga0265319_1006421
280 Ga0265334_10056248
281 Ga0265318_10003696
282 Ga0265324_10016611
283 Ga0265331_10022486
284 Ga0265314_10110879
285 Ga0265314_10233010
286 Ga0307405_10081194
287 Ga0307405_10092937
288 Ga0307413_10143716
289 Ga0307406_10374500
290 Ga0307416_100005051
291 Ga0307416_100345904
292 Ga0307415_100092416
293 Ga0307415_100254051
294 Ga0395901_0570968
295 Ga0451793_0332728
296 Ga0451839_1319808
297 Ga0451853_3782085
298 Ga0450920_021717
299 Ga0451577_0008264
300 Ga0451577_0415228
301 Ga0495592_0426515
302 Ga0495651_0333481
303 Ga0495653_0161687
304 Ga0495594_0191270
305 Ga0495652_0563085
306 Ga0495599_0174339
307 Ga0495647_0148753
308 Ga0495604_0452345
309 Ga0496107_0193906
310 Ga0496107_0318876
311 Ga0496109_0225223
312 Ga0496109_0258221
313 Ga0496111_0091406
314 Ga0496112_0536542
315 Ga0501031_0066453
316 Ga0501031_0088267
317 Ga0501031_0153378
318 Ga0501031_0173176
319 Ga0501031_0211452
320 Ga0501036_0004700
321 Ga0501038_0084925
322 Ga0501038_0257377
323 Ga0501038_0394385
324 Ga0501038_0412876
325 Ga0501039_0016293
326 Ga0501039_0041687
327 Ga0501039_0102899
328 Ga0501040_0007441
329 Ga0501040_0181292
330 Ga0501040_0215017
331 Ga0501040_0434003
332 Ga0501040_0489864
333 Ga0501041_0078957
334 Ga0501041_0170611
335 Ga0501042_0011304
336 Ga0501042_0042682
337 Ga0501042_0050721
338 Ga0501042_0085608
339 Ga0501042_0088055
340 Ga0501042_0349528
341 Ga0501043_0439570
342 Ga0501046_0074144
343 Ga0501046_0176741
344 Ga0501046_0192637
345 Ga0501046_0209288
346 Ga0501048_0033704
347 Ga0501048_0058289
348 Ga0501048_0096250
349 Ga0501067_0003145
350 Ga0501067_0095738
351 Ga0501068_0049851
352 Ga0501068_0052213
353 Ga0501068_0086173
354 Ga0501068_0090542
355 Ga0501068_0193480
356 Ga0501069_0007787
357 Ga0501069_0434546
358 Ga0501070_0131296
359 Ga0501070_0381817
360 Ga0501071_0007765
361 Ga0501071_0038206
362 Ga0501071_0054218
363 Ga0501071_0063331
364 Ga0501071_0158817
365 Ga0501072_0003834
366 Ga0501072_0099240
367 Ga0501072_0122440
368 Ga0501073_0249916
369 Ga0501074_0113485
370 Ga0501074_0121229
371 Ga0501074_0166864
372 Ga0501074_0174750
373 Ga0501074_0238993
374 Ga0501074_0432200
375 Ga0501075_0024763
376 Ga0501075_0151490
377 Ga0501075_0178678
378 Ga0501075_0270888
379 Ga0501075_0350724
380 Ga0501076_0073384
381 Ga0501076_0108059
382 Ga0501076_0114161
383 Ga0501076_0134566
384 Ga0501076_0269907
385 Ga0501077_0036502
386 Ga0501077_0352875
387 Ga0501079_0005897
388 Ga0501079_0010632
389 Ga0501079_0028620
390 Ga0501079_0117728
391 Ga0501079_0128434
392 Ga0501080_0026278
393 Ga0501080_0061104
394 Ga0501080_0409965
395 Ga0501080_0593487
396 Ga0501081_0014319
397 Ga0501081_0030682
398 Ga0501081_0061351
399 Ga0501081_0085859
400 Ga0501081_0102303
401 Ga0501081_0149033
402 Ga0501081_0284398
403 Ga0501035_0021079
404 Ga0501035_0229606
405 Ga0501044_0701957
406 Ga0501045_0037204
407 Ga0501045_0043211
408 Ga0501045_0069604
409 Ga0501045_0109899
410 Ga0501045_0198421
411 nmdc:mga05p37_186358_c1
412 nmdc:mga05p37_224573_c1
413 nmdc:mga0n895_39978_c1
414 nmdc:mga0rr50_102979_c1
415 nmdc:mga0rr50_140220_c1
416 nmdc:mga0a205_193798_c1
417 nmdc:mga0a205_280120_c1
418 Ga0495595_0043584
419 Ga0495619_0045730
420 Ga0495619_0246144
421 Ga0501084_0120947
422 Ga0501084_0222436
423 Ga0501082_0016143
424 Ga0501082_0142602
425 Ga0501082_0163647
426 Ga0501082_0272028
427 Ga0501082_0362187
428 Ga0530510_0015328
429 Ga0530510_0035444
430 Ga0530510_0048777
431 Ga0530510_0081988
432 Ga0530510_0124609
433 Ga0530510_0152152
434 Ga0530510_0401206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

103

226

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.4616 13 185
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.4482 6 184
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.4459 14 176
3p8c-assembly1.cif.gz_A structure and control of the actin regulatory wave complex 0.4309 81 148
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.4144 14 184
ID Description Score Start End Superfamily
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6818 113 210 1.10.3720.10
af_Q2FVX5_4_220_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5755 51 176 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5597 113 210 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5508 51 176 1.10.3720.10
af_Q2FVH1_15_213_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.528 49 216 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A530BCU1-F1-model_v4 ABC transporter permease subunit 0.7582 84 179 GO:0005886
GO:0055085
AF-A0A519YA77-F1-model_v4 deleted 0.758 98 214
AF-A0A442AS13-F1-model_v4 ABC transporter permease subunit 0.7491 100 199 GO:0005886
GO:0010438
GO:0055085
AF-A0A522B9Z3-F1-model_v4 ABC transporter permease subunit 0.7439 92 217 GO:0005886
GO:0055085
AF-A0A537LP19-F1-model_v4 ABC transporter permease subunit 0.7357 92 217 GO:0005886
GO:0055085

Map