F328701

General Info

Members Datasets Scaffolds Average Seq Length
217 151 434 303

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10075809|Ga0111539_100758093
Length 358
Sequence VTDPDGDFSSFLRDVKPCCHGIECFSKNSQLVAHLRFDFRRWGALASVWLMSTSSRWLRVLLLSSVGFFSGFGAHAEDTALLEIERRVAHGFATNNGVRIHYAALGQGPLIVMIHGFPDCWLTWRMVMDTLAKDYEAVAIDQRGYNLSDKPRGVEHYDMAALVEDVAAVVRARGRERAIIAGHDWGGAVAWSFAMKRPEMTEKLIILNLPHPRGIGRELVRNPQQQKASAYARRFQQEGAHTNLTAEGLALWVTNAQAKARYIEAFRRSDFEAMLNYYKRNYPREPYAEDTSPVVKVKCPVLMIHGLKDTALLSAGLNGNWDFVEKDFTLVTIPDAGHFVQQDAPEMVKRSIRSWLAR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
103 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
149 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
150 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 3.23
Rhizosphere 96.31
Stem 0
Stem Tuber 0
Unclassified 5.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10075809 3300009094 Unclassified 3961
2 Ga0065712_10076306 3300005290 Bacteria 3624
3 Ga0065715_10187892 3300005293 Bacteria 1433
4 Ga0070676_10095281 3300005328 Bacteria 1830
5 Ga0070683_100150922 3300005329 Bacteria 2203
6 Ga0070683_100423433 3300005329 Bacteria 1270
7 Ga0070670_100050140 3300005331 Bacteria 3588
8 Ga0070670_100056412 3300005331 Bacteria 3371
9 Ga0070670_100114452 3300005331 Bacteria 2325
10 Ga0068869_100051548 3300005334 Bacteria 2986
11 Ga0068868_100192167 3300005338 Bacteria 1698
12 Ga0070668_100084833 3300005347 Bacteria 2488
13 Ga0070669_100137248 3300005353 Unclassified 1882
14 Ga0070674_100015960 3300005356 Bacteria 4701
15 Ga0070673_100173934 3300005364 Bacteria 1839
16 Ga0070673_100190124 3300005364 Bacteria 1763
17 Ga0070703_10000020 3300005406 Bacteria 77365
18 Ga0070703_10100420 3300005406 Bacteria 1019
19 Ga0070709_10000347 3300005434 Bacteria 28778
20 Ga0070709_10021011 3300005434 Bacteria 3799
21 Ga0070711_100018125 3300005439 Bacteria 4491
22 Ga0070705_100000011 3300005440 Bacteria 101991
23 Ga0070700_100298681 3300005441 Bacteria 1175
24 Ga0070706_100000334 3300005467 Bacteria 57062
25 Ga0070706_100037828 3300005467 Bacteria 4456
26 Ga0070706_100379334 3300005467 Bacteria 1317
27 Ga0070707_100000671 3300005468 Bacteria 33971
28 Ga0070698_100023173 3300005471 Bacteria 6491
29 Ga0070698_100164441 3300005471 Unclassified 2162
30 Ga0070699_100000049 3300005518 Bacteria 117880
31 Ga0070696_100000001 3300005546 Bacteria 174282
32 Ga0070696_100009080 3300005546 Bacteria 6659
33 Ga0070696_100021729 3300005546 Bacteria 4353
34 Ga0070693_100003648 3300005547 Bacteria 7192
35 Ga0070665_100004417 3300005548 Bacteria 14774
36 Ga0070665_100068172 3300005548 Bacteria 3567
37 Ga0070704_100029329 3300005549 Bacteria 3672
38 Ga0070664_100094410 3300005564 Bacteria 2594
39 Ga0068857_100267426 3300005577 Bacteria 1571
40 Ga0068859_100593793 3300005617 Bacteria 1201
41 Ga0068864_100023526 3300005618 Bacteria 5174
42 Ga0068866_10017979 3300005718 Bacteria 3190
43 Ga0068858_100015240 3300005842 Bacteria 7231
44 Ga0068858_100059644 3300005842 Bacteria 3526
45 Ga0068860_100577795 3300005843 Bacteria 1128
46 Ga0068862_100026914 3300005844 Bacteria 4837
47 Ga0068862_100118649 3300005844 Bacteria 2329
48 Ga0068862_100523397 3300005844 Bacteria 1129
49 Ga0081455_10031110 3300005937 Bacteria 4834
50 Ga0081540_1014460 3300005983 Bacteria 5054
51 Ga0081539_10000694 3300005985 Bacteria 67521
52 Ga0070717_10008907 3300006028 Bacteria 7518
53 Ga0070717_10031855 3300006028 Plasmid 4244
54 Ga0097621_100006226 3300006237 Bacteria 8462
55 Ga0068871_100002064 3300006358 Bacteria 13615
56 Ga0068871_100264241 3300006358 Bacteria 1502
57 Ga0075428_100083691 3300006844 Bacteria 3481
58 Ga0075431_100047986 3300006847 Bacteria 4404
59 Ga0075431_100146646 3300006847 Bacteria 2432
60 Ga0075431_100160297 3300006847 Bacteria 2313
61 Ga0075431_100177981 3300006847 Bacteria 2183
62 Ga0075431_100595486 3300006847 Bacteria 1090
63 Ga0075434_100063716 3300006871 Bacteria 3669
64 Ga0068865_100002557 3300006881 Bacteria 10791
65 Ga0097620_100593801 3300006931 Bacteria 1201
66 Ga0075435_100025256 3300007076 Bacteria 4623
67 Ga0105240_10147098 3300009093 Bacteria 2810
68 Ga0105240_10636490 3300009093 Bacteria 1171
69 Ga0111539_10374889 3300009094 Bacteria 1656
70 Ga0111539_10482170 3300009094 Bacteria 1444
71 Ga0105247_10177200 3300009101 Bacteria 1421
72 Ga0105247_10262455 3300009101 Unclassified 1185
73 Ga0114129_10004466 3300009147 Bacteria 19730
74 Ga0114129_10017711 3300009147 Bacteria 10144
75 Ga0105243_10236479 3300009148 Bacteria 1623
76 Ga0105242_10012011 3300009176 Bacteria 6667
77 Ga0105248_10089877 3300009177 Bacteria 3458
78 Ga0105248_10205915 3300009177 Bacteria 2217
79 Ga0105248_10433530 3300009177 Bacteria 1480
80 Ga0105249_10171962 3300009553 Bacteria 2102
81 Ga0105249_10351226 3300009553 Bacteria 1494
82 Ga0105239_10657484 3300010375 Bacteria 1197
83 Ga0157374_10156999 3300013296 Bacteria 2215
84 Ga0163162_10196470 3300013306 Bacteria 2146
85 Ga0157372_10155351 3300013307 Unclassified 2642
86 Ga0157375_10000051 3300013308 Bacteria 130143
87 Ga0163163_10000045 3300014325 Bacteria 135325
88 Ga0163163_10036526 3300014325 Bacteria 4774
89 Ga0163163_10190354 3300014325 Bacteria 2100
90 Ga0157380_10001867 3300014326 Bacteria 13939
91 Ga0157380_10071207 3300014326 Bacteria 2812
92 Ga0157379_10083617 3300014968 Bacteria 2861
93 Ga0157379_10150048 3300014968 Bacteria 2102
94 Ga0157376_10021067 3300014969 Bacteria 5058
95 Ga0157376_10174499 3300014969 Bacteria 1960
96 Ga0163161_10321060 3300017792 Bacteria 1224
97 Ga0207653_10000006 3300025885 Bacteria 202194
98 Ga0207680_10022255 3300025903 Bacteria 3444
99 Ga0207699_10000131 3300025906 Bacteria 51761
100 Ga0207684_10002390 3300025910 Bacteria 19002
101 Ga0207684_10269503 3300025910 Bacteria 1469
102 Ga0207684_10358068 3300025910 Bacteria 1256
103 Ga0207695_10088137 3300025913 Bacteria 3125
104 Ga0207663_10095698 3300025916 Bacteria 1982
105 Ga0207662_10098646 3300025918 Bacteria 1808
106 Ga0207646_10000151 3300025922 Bacteria 95358
107 Ga0207650_10120296 3300025925 Bacteria 2044
108 Ga0207659_10217984 3300025926 Bacteria 1533
109 Ga0207687_10084706 3300025927 Bacteria 2298
110 Ga0207687_10089730 3300025927 Bacteria 2239
111 Ga0207664_10038781 3300025929 Unclassified 3695
112 Ga0207706_10107943 3300025933 Bacteria 2449
113 Ga0207686_10054494 3300025934 Bacteria 2505
114 Ga0207670_10144648 3300025936 Bacteria 1757
115 Ga0207669_10077895 3300025937 Bacteria 2110
116 Ga0207704_10195420 3300025938 Bacteria 1475
117 Ga0207665_10105311 3300025939 Unclassified 1975
118 Ga0207691_10179020 3300025940 Bacteria 1853
119 Ga0207711_10166887 3300025941 Bacteria 1996
120 Ga0207689_10265988 3300025942 Bacteria 1419
121 Ga0207689_10289270 3300025942 Bacteria 1357
122 Ga0207661_10144909 3300025944 Bacteria 2048
123 Ga0207677_10285304 3300026023 Bacteria 1357
124 Ga0207703_10028614 3300026035 Bacteria 4395
125 Ga0207708_10010553 3300026075 Bacteria 6857
126 Ga0207641_10098119 3300026088 Unclassified 2576
127 Ga0207648_10081810 3300026089 Bacteria 2816
128 Ga0207676_10007096 3300026095 Bacteria 7941
129 Ga0207676_10149332 3300026095 Bacteria 2011
130 Ga0207674_10056750 3300026116 Bacteria 3974
131 Ga0207675_100021552 3300026118 Bacteria 6002
132 Ga0207675_100576862 3300026118 Bacteria 1126
133 Ga0207428_10040801 3300027907 Bacteria 3760
134 Ga0207428_10238775 3300027907 Bacteria 1358
135 Ga0207428_10274709 3300027907 Bacteria 1252
136 Ga0268266_10125440 3300028379 Bacteria 2290
137 Ga0268265_10077986 3300028380 Bacteria 2604
138 Ga0268264_10133683 3300028381 Bacteria 2203
139 Ga0265338_10025985 3300028800 Bacteria 5920
140 Ga0307415_100113690 3300032126 Archaea 2014
141 Ga0373927_0003547 3300035695 Bacteria 11154
142 Ga0373947_0115042 3300035725 Bacteria 1704
143 Ga0373937_0002413 3300036401 Bacteria 15536
144 Ga0439439_0045218 3300041406 Bacteria 1148
145 Ga0450896_008315 3300042133 Unclassified 1438
146 Ga0453684_0260463 3300044712 Bacteria 1987
147 Ga0451576_0370941 3300045051 Unclassified 1500
148 Ga0451576_0584089 3300045051 Bacteria 1174
149 Ga0466967_0683512 3300045976 Bacteria 1016
150 Ga0495653_0077301 3300046463 Bacteria 2472
151 Ga0495628_0069900 3300046516 Bacteria 2738
152 Ga0495630_0138734 3300046517 Bacteria 1848
153 Ga0495652_0148933 3300046529 Bacteria 1831
154 Ga0495640_0285905 3300046533 Bacteria 1026
155 Ga0495645_0001686 3300046543 Bacteria 15010
156 Ga0495635_0183717 3300046663 Bacteria 1421
157 Ga0495658_0055390 3300046683 Bacteria 2259
158 Ga0495581_0128447 3300047315 Bacteria 1477
159 Ga0495674_0052277 3300047319 Bacteria 3596
160 Ga0496105_0378531 3300048908 Bacteria 1127
161 Ga0496110_0549481 3300048913 Bacteria 1050
162 Ga0496112_0224400 3300048915 Bacteria 1834
163 Ga0496112_0283923 3300048915 Bacteria 1602
164 Ga0496114_0141963 3300048917 Bacteria 2080
165 Ga0496114_0151161 3300048917 Bacteria 2014
166 Ga0496114_0156852 3300048917 Bacteria 1977
167 Ga0501031_0072356 3300049568 Bacteria 2245
168 Ga0501036_0021731 3300049572 Bacteria 5394
169 Ga0501040_0205900 3300049576 Bacteria 1398
170 Ga0501042_0067148 3300049578 Bacteria 2564
171 Ga0501046_0112290 3300049580 Bacteria 2081
172 Ga0501071_0107681 3300049587 Bacteria 2058
173 Ga0501072_0027963 3300049588 Bacteria 4401
174 Ga0501072_0286704 3300049588 Bacteria 1309
175 Ga0501072_0293303 3300049588 Bacteria 1293
176 Ga0501076_0020968 3300049592 Bacteria 5006
177 Ga0501076_0029023 3300049592 Bacteria 4300
178 Ga0501077_0141543 3300049593 Bacteria 1526
179 Ga0501079_0083273 3300049741 Bacteria 2475
180 Ga0501080_0257921 3300049742 Bacteria 1589
181 Ga0501081_0034008 3300049743 Bacteria 3466
182 Ga0501045_0005638 3300049824 Bacteria 8665
183 Ga0501045_0006427 3300049824 Bacteria 8140
184 Ga0501045_0216185 3300049824 Bacteria 1427
185 Ga0501045_0360048 3300049824 Bacteria 1083
186 nmdc:mga05p37_1133_c1 3300050507 Bacteria 30583
187 nmdc:mga05p37_12301_c1 3300050507 Bacteria 10220
188 nmdc:mga05p37_662560_c1 3300050507 Bacteria 1166
189 nmdc:mga05p37_81690_c1 3300050507 Bacteria 3981
190 nmdc:mga05p37_98624_c1 3300050507 Unclassified 3599
191 nmdc:mga09592_79463_c1 3300050508 Bacteria 2792
192 nmdc:mga0qj67_251702_c1 3300050509 Bacteria 1433
193 nmdc:mga06r32_173165_c1 3300050510 Bacteria 2143
194 nmdc:mga06r32_72637_c1 3300050510 Bacteria 3331
195 nmdc:mga06r32_86303_c1 3300050510 Bacteria 3061
196 nmdc:mga08y16_57254_c1 3300050511 Bacteria 4074
197 nmdc:mga08y16_82746_c1 3300050511 Bacteria 3346
198 nmdc:mga0n895_330278_c1 3300050512 Bacteria 1545
199 nmdc:mga0n895_683799_c1 3300050512 Bacteria 1023
200 nmdc:mga0rr50_97976_c1 3300050513 Bacteria 2297
201 nmdc:mga08x19_110342_c1 3300050514 Unclassified 1834
202 Ga0495601_0177714 3300053077 Archaea 1392
203 Ga0495595_0060846 3300053084 Bacteria 1768
204 Ga0495619_0025105 3300053085 Bacteria 3825
205 Ga0495619_0047309 3300053085 Bacteria 2832
206 Ga0500658_0091826 3300053134 Bacteria 1314
207 Ga0501084_0053716 3300054114 Bacteria 3370
208 Ga0501084_0104393 3300054114 Bacteria 2380
209 Ga0590071_000293 3300059421 Bacteria 14574
210 Ga0590071_000647 3300059421 Bacteria 9898
211 Ga0590074_000844 3300059423 Bacteria 4749
212 Ga0590075_000334 3300059424 Bacteria 13118
213 Ga0590075_000942 3300059424 Bacteria 7557
214 Ga0590077_000061 3300059426 Bacteria 26882
215 Ga0590077_000806 3300059426 Bacteria 8105
216 Ga0501082_0068158 3300060353 Bacteria 3064
217 Ga0501082_0167814 3300060353 Bacteria 1908
218 Ga0111539_10075809
219 Ga0065712_10076306
220 Ga0065715_10187892
221 Ga0070676_10095281
222 Ga0070683_100150922
223 Ga0070683_100423433
224 Ga0070670_100050140
225 Ga0070670_100056412
226 Ga0070670_100114452
227 Ga0068869_100051548
228 Ga0068868_100192167
229 Ga0070668_100084833
230 Ga0070669_100137248
231 Ga0070674_100015960
232 Ga0070673_100173934
233 Ga0070673_100190124
234 Ga0070703_10000020
235 Ga0070703_10100420
236 Ga0070709_10000347
237 Ga0070709_10021011
238 Ga0070711_100018125
239 Ga0070705_100000011
240 Ga0070700_100298681
241 Ga0070706_100000334
242 Ga0070706_100037828
243 Ga0070706_100379334
244 Ga0070707_100000671
245 Ga0070698_100023173
246 Ga0070698_100164441
247 Ga0070699_100000049
248 Ga0070696_100000001
249 Ga0070696_100009080
250 Ga0070696_100021729
251 Ga0070693_100003648
252 Ga0070665_100004417
253 Ga0070665_100068172
254 Ga0070704_100029329
255 Ga0070664_100094410
256 Ga0068857_100267426
257 Ga0068859_100593793
258 Ga0068864_100023526
259 Ga0068866_10017979
260 Ga0068858_100015240
261 Ga0068858_100059644
262 Ga0068860_100577795
263 Ga0068862_100026914
264 Ga0068862_100118649
265 Ga0068862_100523397
266 Ga0081455_10031110
267 Ga0081540_1014460
268 Ga0081539_10000694
269 Ga0070717_10008907
270 Ga0070717_10031855
271 Ga0097621_100006226
272 Ga0068871_100002064
273 Ga0068871_100264241
274 Ga0075428_100083691
275 Ga0075431_100047986
276 Ga0075431_100146646
277 Ga0075431_100160297
278 Ga0075431_100177981
279 Ga0075431_100595486
280 Ga0075434_100063716
281 Ga0068865_100002557
282 Ga0097620_100593801
283 Ga0075435_100025256
284 Ga0105240_10147098
285 Ga0105240_10636490
286 Ga0111539_10374889
287 Ga0111539_10482170
288 Ga0105247_10177200
289 Ga0105247_10262455
290 Ga0114129_10004466
291 Ga0114129_10017711
292 Ga0105243_10236479
293 Ga0105242_10012011
294 Ga0105248_10089877
295 Ga0105248_10205915
296 Ga0105248_10433530
297 Ga0105249_10171962
298 Ga0105249_10351226
299 Ga0105239_10657484
300 Ga0157374_10156999
301 Ga0163162_10196470
302 Ga0157372_10155351
303 Ga0157375_10000051
304 Ga0163163_10000045
305 Ga0163163_10036526
306 Ga0163163_10190354
307 Ga0157380_10001867
308 Ga0157380_10071207
309 Ga0157379_10083617
310 Ga0157379_10150048
311 Ga0157376_10021067
312 Ga0157376_10174499
313 Ga0163161_10321060
314 Ga0207653_10000006
315 Ga0207680_10022255
316 Ga0207699_10000131
317 Ga0207684_10002390
318 Ga0207684_10269503
319 Ga0207684_10358068
320 Ga0207695_10088137
321 Ga0207663_10095698
322 Ga0207662_10098646
323 Ga0207646_10000151
324 Ga0207650_10120296
325 Ga0207659_10217984
326 Ga0207687_10084706
327 Ga0207687_10089730
328 Ga0207664_10038781
329 Ga0207706_10107943
330 Ga0207686_10054494
331 Ga0207670_10144648
332 Ga0207669_10077895
333 Ga0207704_10195420
334 Ga0207665_10105311
335 Ga0207691_10179020
336 Ga0207711_10166887
337 Ga0207689_10265988
338 Ga0207689_10289270
339 Ga0207661_10144909
340 Ga0207677_10285304
341 Ga0207703_10028614
342 Ga0207708_10010553
343 Ga0207641_10098119
344 Ga0207648_10081810
345 Ga0207676_10007096
346 Ga0207676_10149332
347 Ga0207674_10056750
348 Ga0207675_100021552
349 Ga0207675_100576862
350 Ga0207428_10040801
351 Ga0207428_10238775
352 Ga0207428_10274709
353 Ga0268266_10125440
354 Ga0268265_10077986
355 Ga0268264_10133683
356 Ga0265338_10025985
357 Ga0307415_100113690
358 Ga0373927_0003547
359 Ga0373947_0115042
360 Ga0373937_0002413
361 Ga0439439_0045218
362 Ga0450896_008315
363 Ga0453684_0260463
364 Ga0451576_0370941
365 Ga0451576_0584089
366 Ga0466967_0683512
367 Ga0495653_0077301
368 Ga0495628_0069900
369 Ga0495630_0138734
370 Ga0495652_0148933
371 Ga0495640_0285905
372 Ga0495645_0001686
373 Ga0495635_0183717
374 Ga0495658_0055390
375 Ga0495581_0128447
376 Ga0495674_0052277
377 Ga0496105_0378531
378 Ga0496110_0549481
379 Ga0496112_0224400
380 Ga0496112_0283923
381 Ga0496114_0141963
382 Ga0496114_0151161
383 Ga0496114_0156852
384 Ga0501031_0072356
385 Ga0501036_0021731
386 Ga0501040_0205900
387 Ga0501042_0067148
388 Ga0501046_0112290
389 Ga0501071_0107681
390 Ga0501072_0027963
391 Ga0501072_0286704
392 Ga0501072_0293303
393 Ga0501076_0020968
394 Ga0501076_0029023
395 Ga0501077_0141543
396 Ga0501079_0083273
397 Ga0501080_0257921
398 Ga0501081_0034008
399 Ga0501045_0005638
400 Ga0501045_0006427
401 Ga0501045_0216185
402 Ga0501045_0360048
403 nmdc:mga05p37_1133_c1
404 nmdc:mga05p37_12301_c1
405 nmdc:mga05p37_662560_c1
406 nmdc:mga05p37_81690_c1
407 nmdc:mga05p37_98624_c1
408 nmdc:mga09592_79463_c1
409 nmdc:mga0qj67_251702_c1
410 nmdc:mga06r32_173165_c1
411 nmdc:mga06r32_72637_c1
412 nmdc:mga06r32_86303_c1
413 nmdc:mga08y16_57254_c1
414 nmdc:mga08y16_82746_c1
415 nmdc:mga0n895_330278_c1
416 nmdc:mga0n895_683799_c1
417 nmdc:mga0rr50_97976_c1
418 nmdc:mga08x19_110342_c1
419 Ga0495601_0177714
420 Ga0495595_0060846
421 Ga0495619_0025105
422 Ga0495619_0047309
423 Ga0500658_0091826
424 Ga0501084_0053716
425 Ga0501084_0104393
426 Ga0590071_000293
427 Ga0590071_000647
428 Ga0590074_000844
429 Ga0590075_000334
430 Ga0590075_000942
431 Ga0590077_000061
432 Ga0590077_000806
433 Ga0501082_0068158
434 Ga0501082_0167814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

109

345

0.78

PF12146

Hydrolase_4

Serine aminopeptidase, S33

108

344

0.65

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

111

350

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o08-assembly2.cif.gz_B crystal structure of bacillus megaterium epoxide hydrolase in complex with an inhibitor 0.8913 30 306
5ng7-assembly1.cif.gz_A novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments 0.8898 25 302
5nfq-assembly1.cif.gz_A novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments 0.8879 28 305
4inz-assembly2.cif.gz_B the crystal structure of m145a mutant of an epoxide hydrolase from bacillus megaterium 0.8827 30 306
4io0-assembly2.cif.gz_B crystal structure of f128a mutant of an epoxide hydrolase from bacillus megaterium complexed with its product (r)-3-[1]naphthyloxy-propane-1,2-diol 0.8682 30 306
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9178 25 115 3.40.50.12270
5ng7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9131 25 305 3.40.50.1820
4o08B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8913 30 306 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8902 25 115 3.40.50.12270
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.885 28 151 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2D4PZP1-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9512 38 151 GO:0004301
AF-A0A6N6PWU4-F1-model_v4 Alpha/beta hydrolase 0.95 21 306 GO:0016787
AF-A0A2T0QJH6-F1-model_v4 Alpha/beta hydrolase family protein 0.9489 28 151 GO:0016787
AF-A0A2M8NMB5-F1-model_v4 Alpha/beta hydrolase 0.9377 36 186 GO:0016787
AF-A0A382IUK5-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9292 11 175 GO:0003824

Map